(data stored in ACNUC7421 zone)

EMBL: CP001349.PE494

CP001349.PE494       Location/Qualifiers
FT   CDS_pept        complement(570325..570462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55546"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55546.1"
FT                   /translation="MDLLLLFIAAVPAAILGLALLGWHAHKTRRPPADGVIHRSRGYLL
FT                   "
     atggatctcc tgctgctctt cattgccgcc gttccggccg cgatcctggg gctcgctctt        60
     ctcggctggc acgctcacaa gacccggcgg ccgcctgccg acggcgtgat ccaccgctcg       120
     cgcggctatc tcctgtga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page