(data stored in ACNUC7421 zone)

EMBL: CP001349.PE495

CP001349.PE495       Location/Qualifiers
FT   CDS_pept        571031..573421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0506"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: met:M446_1046 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55547"
FT                   /db_xref="GOA:B8ICF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF9"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACL55547.1"
FT                   /translation="MPRPPRDWLDIGSEPSTGGAAGAPPPRLAERARAARDHVRTGLGA
FT                   VRAAAARAAAHPAARRAAAGAAAAWRPVRRGAARIPWGRTIAGTLALAALLIAGLVVYA
FT                   LATLPVNGGLAIEPTASALVVRAEGGQAFATRGVIKGAKLNPREVPKVLAEAIVAIEDR
FT                   RFYAHHGIDLRGLARAAFRNLAAGGTREGGSTLTQQLVRMSYLSQDRTLKRKVQEAILA
FT                   LWLESQLPKEEILTRYLNAAYFGAGVYGADAAAQRYFGKPARDLSLSEAAMLAGLVRAP
FT                   SQLAPHRNLDGARGRAAQVLEAMVETGAITPAEAEAARRNPAAVQVPTDTPVGTNYFVD
FT                   MVADQAKALIGAGPADASLRTTLDLTLQNIAESVLARRLDQDGERRKVSQGALVAMATD
FT                   GAILAMVGGRDYAESQFNRVTQARRQPGSIFKLFVYLTALRNGYRPDSVMMDRPTQVGE
FT                   WEPENYGGRYRGAVTLRSAFAQSINTVAVQLAEAVGIPAVIETAKALGVQSDLPNLPSL
FT                   ALGSAETTLLELTRAYAAVAAGAESVEPYAIRQIASRDQILYTRPATALPPARDTAARA
FT                   GMLDLLAAVMREGTGKGARVAVPAGGKTGTTQDNRDAWFIGFAGDLVVGVWLGNDDNAP
FT                   MQGVTGGDLPAAIWRDFVTQALAVRGRAAKAQAARPERPPPRSEMAAADPDADQRPGRG
FT                   SLRGTPSVIDTGTLNLDGQTVRLLGVEGLAGRNARELGRYLRRRDVACLPAEGGAYRCS
FT                   LDGQDLSELILFNGGGRAGADATPDLLAAEEQARSNRIGIWRR"
     atgccccggc cgccgcgcga ctggctcgat atcggatcgg agcccagcac cggcggcgcg        60
     gccggagctc cgccaccgcg gctcgccgag cgggcgcgcg cggcccggga tcatgttcgg       120
     accggcctcg gcgcggtgcg tgcggcggcg gcgcgggccg cggcgcaccc ggccgcacgg       180
     cgggcagcgg ccggcgctgc cgccgcatgg cggccggtgc ggcgcggcgc ggcgcggatt       240
     ccctggggac ggacgatcgc cggcaccctc gcgctcgccg cgctcctgat cgccggcctc       300
     gtcgtctatg ccctcgcgac gctgccggtg aatggcggcc tcgcgatcga gccgaccgcc       360
     tccgccctgg tggtgcgggc cgagggcggg caggccttcg cgacccgcgg cgtcatcaag       420
     ggcgcgaagc tcaacccccg cgaggtgccg aaggtcctgg ctgaggccat cgtcgccatc       480
     gaggaccggc gcttctacgc gcatcacggc atcgacctgc gcgggctcgc ccgcgcggca       540
     ttccgcaatc tcgcggcggg cggcacccgc gagggcggca gcacgctcac ccagcagctc       600
     gtgcggatga gctatctatc gcaggaccgc acgctgaagc ggaaggtcca ggaagcgatc       660
     ctcgccctct ggctcgaatc gcagctcccc aaggaggaga tcctcacccg ctatctcaac       720
     gccgcctatt tcggggcggg cgtctacggg gccgacgcgg cggcccagcg ctatttcggc       780
     aagccggccc gcgacctcag cttgagcgaa gccgccatgc tggcgggcct cgtgcgcgcg       840
     ccctcgcagc tcgcgcccca ccgcaacctc gacggcgccc gcggccgggc cgcccaggtg       900
     ctggaggcca tggtggagac cggggccatc acgcccgccg aggccgaggc cgcccgcagg       960
     aacccggcgg ccgtgcaggt gccgaccgac acgccggtcg gcacgaacta tttcgtcgac      1020
     atggtcgccg accaggccaa ggccctgatc ggcgccggac cggccgacgc ctcgctgcgc      1080
     accaccctcg acctgacgct ccagaacatc gccgagagcg tgctcgcccg ccgcctcgac      1140
     caggacgggg agcggcgcaa ggtctcccag ggagcgctcg tcgccatggc gaccgacggg      1200
     gcgatcctgg cgatggtcgg cggacgcgac tacgccgaga gccagttcaa ccgggtgacg      1260
     caggcgcgcc gccagccggg ctcgatcttc aagctcttcg tctacctgac ggccctgagg      1320
     aacggctacc ggcccgattc ggtgatgatg gaccgcccga cgcaggtcgg cgaatgggag      1380
     ccggagaatt acggcgggcg ctaccggggc gccgtcaccc tgcgctccgc cttcgcgcag      1440
     tcgatcaaca ccgtggcggt gcagctcgcc gaggcggtcg gcatcccggc ggtgatcgag      1500
     accgccaaag cgctcggcgt ccagtcggac ctgccgaacc tgccgagcct cgccctcggc      1560
     tccgccgaga cgacgctcct cgaactcacc cgggcctacg cggccgtggc ggcgggggcc      1620
     gagagcgtcg agccctatgc catccggcag atcgcgagcc gcgatcagat cctgtacacg      1680
     cggcccgcca ccgcgctgcc gcccgcccgc gacactgcgg cccgggccgg gatgctcgat      1740
     ctcctcgcgg ccgtgatgcg ggagggcacc ggcaagggcg cgcgcgtcgc cgtgcccgcg      1800
     ggcggaaaga ccggcaccac gcaggacaac cgcgacgcgt ggttcatcgg ctttgcgggc      1860
     gatctcgtgg tcggggtctg gctcggcaac gacgacaacg cgccgatgca gggcgttacc      1920
     ggcggcgatc tgccggccgc gatctggcgg gacttcgtca cccaggccct cgccgtgcgg      1980
     ggccgcgccg ccaaggccca ggccgccagg cccgagcggc cgccgccgcg gtccgagatg      2040
     gccgccgccg atcccgacgc cgatcagcgg ccgggccgcg gatcgctgcg cggcaccccc      2100
     tcggtgatcg acaccggcac cctgaacttg gacggtcaga cggtccggct cctcggcgtg      2160
     gaggggctgg cgggccgcaa cgcccgcgag ctcggccgct atctgcgccg ccgcgacgtc      2220
     gcctgcctgc ccgccgaggg cggcgcctat cgctgcagcc tcgacgggca ggacctctcg      2280
     gagctgatcc tgttcaacgg cggcggccgg gccggcgccg acgcgacgcc ggatctgctc      2340
     gcggccgagg agcaggcccg ctcgaaccgc atcgggatct ggcggcgcta g               2391
//

If you have problems or comments...

PBIL Back to PBIL home page