(data stored in ACNUC7421 zone)

EMBL: CP001349.PE496

CP001349.PE496       Location/Qualifiers
FT   CDS_pept        complement(573459..574118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55548"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG0"
FT                   /inference="similar to AA sequence:KEGG:RPB_4480"
FT                   /protein_id="ACL55548.1"
FT                   /translation="MLAWRNQAKRGALSSFASSLCQIKQRNNPVGTIRHSVSAVLISAL
FT                   AACGYVPVTSMLKLSAIDFRVTDPRALRAAVELPKAMLPRRVVLRFIGRINNGPDQTEE
FT                   FDLEEINDPTVADVGSVKADRRISAYRLTSADANRLTAFRSSLFRQKAEQGGRGEVNLE
FT                   VRTEGCRAGPFASGPVLATTYIKTSETGTYVPLMRNFDLRTIDPKRDLVETAPQCQ"
     atgctggcct ggcgtaatca ggcaaagcgc ggcgcgttga gttcattcgc gtcctctctc        60
     tgccaaatca agcagcggaa caatcccgtg ggcactattc gccattctgt ttcggccgtt       120
     ctcatttccg cgttggcggc ttgcgggtac gtgccggtca cgtccatgct gaagctctcg       180
     gcgatcgact tccgtgtgac agatccacga gcattgcgtg cagcggtgga gctgccgaaa       240
     gccatgttgc ctcgtcgcgt tgtgcttcgc ttcatcggcc ggatcaataa cggccctgac       300
     cagacggaag aattcgacct tgaggagatc aacgatccga ccgtcgccga tgtcggtagc       360
     gtcaaggcgg accggagaat ttcggcctat cgattgacga gtgccgatgc gaatcgcctc       420
     acagccttca gatcatccct gttccgacag aaggcggagc aaggagggag gggcgaggtg       480
     aacctggaag tccgcactga gggctgccgt gcggggccat ttgccagcgg acctgttctg       540
     gccacgacct acataaagac ctccgagacc ggcacttacg tcccgctgat gcgtaacttc       600
     gatctccgta caatcgatcc caagcgagac ctcgtcgaaa cggcgccaca atgccagtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page