(data stored in ACNUC7421 zone)

EMBL: CP001349.PE497

CP001349.PE497       Location/Qualifiers
FT   CDS_pept        574427..575314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0508"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   met:M446_1047 beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55549"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL55549.1"
FT                   /translation="MAQQIPISPEARADGPAGPDGTHAIAPDVAYQRLTLVNVIFVGPP
FT                   GAGDRGWVLIDAGILGSRTAIERAATARFGEGARPSAILLTHGHFDHVGVLEDLAMAWD
FT                   APVWAHPLEKPYLDGSASYPRPDPRVGGGLFSLISPLFPTKPVDVGERLHLLPQDGSVP
FT                   PLPGWRWLHTPGHSVGHVSFWRPVDRLLVAGDAFVTTAQESVYAVALQEPELHGPPRYL
FT                   TLDWEAAHGSVEALARLRPETAITGHGRPLRGPGLREGLDALARDFVIVAVPRDGRYVE
FT                   TPARAEDGSAYRRA"
     atggcgcagc agatcccgat ttcccccgag gcgcgggccg acggcccggc cggtccggac        60
     ggcacccacg ccatcgcgcc ggacgtcgcc tatcagcgcc tcaccctcgt gaacgtgatc       120
     ttcgtcgggc cgcccggggc cggcgaccgc ggctgggtgc tgatcgatgc gggcatcctg       180
     ggttcccgga ccgcgatcga gcgggcggcg accgcccggt tcggcgaggg cgcgcggccc       240
     tccgcgatcc tgctgaccca cggccatttc gatcatgtcg gggtgctgga ggatcttgcg       300
     atggcctggg atgcgccggt ctgggcgcac ccgctggaga agccctatct cgacggcagc       360
     gcctcctatc cgcggccgga tccgcgggtg ggcggcgggc tgttctccct gatctcgccg       420
     ctcttcccga cgaagcccgt cgatgtcggc gagcgcctgc acctgctgcc gcaggacggc       480
     agcgtgccgc ccctgccggg ctggcgctgg ctgcacacgc ccggccattc ggtcggccat       540
     gtctccttct ggcggccggt cgaccggctg ctggtggcgg gcgatgcctt cgtcaccacg       600
     gcgcaggaat ccgtctatgc ggtcgcgctg caggagccgg agctgcacgg gccgccccgc       660
     tacctgacgc tcgactggga ggcggcgcac ggttccgtcg aggcgctggc gcggctgcgg       720
     cccgagaccg ccatcaccgg gcacgggcgc ccgctcaggg ggcccggcct gcgggagggg       780
     ctcgacgcgc tggcgcgcga tttcgtcatc gtggcggtgc cccgcgacgg ccgctacgtg       840
     gagacgcccg cgcgggccga ggacggatcg gcctatcggc gcgcctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page