(data stored in ACNUC7421 zone)

EMBL: CP001349.PE498

CP001349.PE498       Location/Qualifiers
FT   CDS_pept        complement(575716..576576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0509"
FT                   /product="purine nucleotide phosphorylase"
FT                   /note="TIGRFAM: inosine guanosine and xanthosine
FT                   phosphorylase family; purine nucleotide phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1; KEGG:
FT                   met:M446_1622 purine nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55550"
FT                   /db_xref="GOA:B8ICG2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG2"
FT                   /inference="protein motif:TFAM:TIGR01698"
FT                   /protein_id="ACL55550.1"
FT                   /translation="MSRGADPSAAGAAADPRVGQAVARLRAGGFGGPFALAVVAGTGLG
FT                   PLAARIEAPRILPYAEIPHFPVSGVSGHAGQLVAGDLGGRPVLLFQGRAHAYEQGDAAA
FT                   MRVPLGVLAALGAPPLLLTNAAGSLRHEAGPGRLALITDHLNLSGLNPLIGEHSEARFV
FT                   PMVDAYDPGLRKSLHGAAAAADLVLHEGVYAWFLGPSFETPAEIRMAGRLGADLVGMST
FT                   VPEVILARFFGLRVAALSIVTNYAAGFDGGAPHHAETKRVAAAAAEDVGRLLAVWLASG
FT                   GPGEG"
     atgagccgag gtgcggaccc gagcgcagcc ggggccgccg cggatccgcg cgtcgggcaa        60
     gccgtggcgc gcctgcgggc gggcggcttc ggcggcccct tcgcgctcgc cgtcgtggcc       120
     ggcaccggcc tcgggccgct tgcggcgcgc atcgaggcgc cccggatcct gccctacgcg       180
     gagatcccgc acttcccggt ctcgggggtc tcgggtcatg ccgggcagct ggtggcgggc       240
     gatctcggcg gccggcccgt gctgctgttc cagggccggg cgcacgctta cgagcagggc       300
     gatgccgcgg ccatgcgggt tcccctcggt gtcctggcgg ccctcggcgc accgccgctc       360
     ctcctcacca acgcggcggg ctccctgcgc cacgaagccg gccccggccg acttgcgctc       420
     atcaccgacc acctcaacct gtcggggctc aacccgctca tcggcgaaca ctcggaggcg       480
     cgcttcgtgc cgatggtcga cgcctatgat cccggtctgc ggaaaagcct gcacggggcc       540
     gccgcggcgg ctgacctcgt gctccacgag ggcgtctatg cgtggttctt gggcccgagc       600
     ttcgagacgc cggcggagat ccgcatggcg ggccggctcg gggccgatct cgtcggcatg       660
     tcgacggtgc cggaggtgat cctggcgcgg ttcttcggcc tgcgggtcgc cgccctgtcg       720
     atcgtgacca actacgccgc gggcttcgac ggcggcgcgc cgcaccacgc cgagacgaag       780
     cgcgtcgctg ccgcggccgc cgaggatgtc ggccggctcc tcgccgtgtg gctcgcgagc       840
     ggaggtccgg gagaggggta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page