(data stored in ACNUC7421 zone)

EMBL: CP001349.PE499

CP001349.PE499       Location/Qualifiers
FT   CDS_pept        complement(576573..577001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0510"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; KEGG: met:M446_1621 cytidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55551"
FT                   /db_xref="GOA:B8ICG3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG3"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ACL55551.1"
FT                   /translation="MPTVPDRMSPIDALFSAALAVQARAHAPYSGFRVGAAVLDETGAV
FT                   HAGCNVENAAYPVGTCAEAGAIAAMVAGGGRRIAAILVLGDGEALVTPCGACRQRIREF
FT                   AAPDAPVHVAGPEGLRRSFTLDALLPVSFGPDNLGVGA"
     atgccgaccg tgccggaccg catgagcccg atcgacgccc tgttctccgc cgccctggcc        60
     gtgcaggccc gcgcccacgc gccctattcg ggcttccgcg tgggggcggc ggtgctggac       120
     gagacgggcg ccgtccatgc cggctgcaac gtcgagaacg cggcctaccc ggtcggcacc       180
     tgcgcggagg cgggcgccat cgccgccatg gtggcgggcg gaggacggcg catcgccgcc       240
     atcctcgtcc tcggcgacgg cgaggcgctg gtcacgccct gcggcgcctg ccgccagcgc       300
     atccgcgaat tcgccgctcc ggatgcaccg gtccacgtgg cggggcccga gggcttacgc       360
     cgcagcttta ccctcgatgc gttgctgccg gtgtcgttcg gccccgacaa tctcggggtc       420
     ggcgcatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page