(data stored in ACNUC7421 zone)

EMBL: CP001349.PE5

CP001349.PE5         Location/Qualifiers
FT   CDS_pept        6770..8899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0006"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: spe:Spro_1016 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55057"
FT                   /db_xref="GOA:B8ISZ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ5"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACL55057.1"
FT                   /translation="MVKGRVALVVCAAQAAWIGGAVAQGASDPVIALDEISVAGSAPEG
FT                   AVVARGYQPVRSSIVNGTETPILKIPQAVSVVTEQVIRDQQVRTLDEALYNVPGITQAN
FT                   TLGGTQDAVLRRGFGDNRDGSILRDGLRTALPRSFMPTTERVEVLKGPASALYGILDPG
FT                   GLVNIVTKKPRFVPAGTVEAFGTSFNGGGASLDFTGPIEGTELAYRFVAEHRNAEYWRN
FT                   FGTQNQQVLAPSLTWRGDTATVRLFYEFSHYRAPFDRGTIFYPGTHRAVPVPRGRRFDE
FT                   RYNITAGESHVAGFEVNQDLGETWKLDLNYAYSHNFYEDNQARVTAFNAATGRVTRRAD
FT                   ATQDSNFGVHAARLDLTGRVEDPLGFSHELLFGASYDASRVLRTDMIRGPTNAGFSIFA
FT                   PVYGTLPASRAVSAADSDQLERIETAAVYAQDTVAVTERLSLVGGLRYQDFTQQAGKGR
FT                   PFNLNTDVSGGRVVPRVGAVYLLNPETSVYASYSETFRPNSSIASYIGALPPESGEAVE
FT                   VGIKVQTEGITATAAFYDIVKSNVLYTETVNGISVSRTAGRVGSRGFEVDIAGQIAPDW
FT                   SVIATYAYTDAVVLADPLLTGKRLTNVAPQTASLWVTHDFGIVGDGRLRAGAGARYVGY
FT                   RPGDAVNSFKLPDYAVVDAFVAYDTVVAALPTTLQLNIRNLLDTTYYTSSIGTNNLGVE
FT                   VGEPFQVLASARVSF"
     atggtgaagg gtcgggtggc gctggtggtc tgcgcggcgc aggcggcgtg gatcggcgga        60
     gccgtcgcgc agggcgcgag cgatccggtc atcgccctcg acgagatctc cgtcgcgggc       120
     tccgccccgg agggcgccgt ggtggcgcgg ggctaccagc cggtgcgcag cagcatcgtg       180
     aacggcaccg agacgccgat cctcaagatc ccgcaggcgg tcagcgtcgt caccgagcag       240
     gtgatccgcg accagcaggt ccgcaccctc gacgaggcgc tctacaacgt cccgggcatc       300
     acccaggcca acacgctcgg cggcacgcag gatgcggtgc tgcgccgggg cttcggcgac       360
     aaccgcgacg gctcgatcct gcgggacggg ttgcgcaccg cgctgccccg cagcttcatg       420
     cccaccaccg agcgggtgga ggtgctgaaa gggccagcct cggccctcta cggcatcctc       480
     gacccgggcg ggctcgtcaa catcgtcacc aagaagccgc gcttcgtgcc ggccgggacc       540
     gtcgaggcct tcggcaccag cttcaatggc ggcggcgcct cgctcgactt cacggggccg       600
     atcgagggca cggaactcgc ctaccggttc gtggccgagc accgcaatgc cgagtactgg       660
     cgcaatttcg gcacgcagaa ccagcaggtg ctcgccccct cgctcacctg gcggggcgac       720
     accgccacgg tgcggctgtt ctatgagttc tcgcactacc gcgcgccgtt cgaccgcggc       780
     acgatcttct atccgggcac ccacagggcg gtgccggtgc cgcgcggccg gcgcttcgac       840
     gagcgctaca acatcacggc cggcgagagc cacgtggcgg ggttcgaggt gaaccaggac       900
     ctcggcgaga cctggaagct cgacctcaac tacgcctaca gccacaattt ctacgaggac       960
     aaccaggccc gggtgacggc cttcaacgcg gcgaccgggc gcgtgacccg aagggccgac      1020
     gccacccagg actcgaattt cggggtgcat gccgcccgcc tcgacctgac gggccgcgtc      1080
     gaggatccgc tcggcttctc gcacgagctc ctgttcggcg cctcctacga tgcgagccgg      1140
     gtgctgcgca ccgatatgat ccggggcccg acgaatgccg gcttcagcat cttcgcgccc      1200
     gtctacggca ccctgccggc gagccgcgcg gtctcggccg ccgacagcga ccagctcgag      1260
     cgcatcgaga ccgcggccgt ctacgcgcag gacaccgtgg cggtgaccga gcggctcagc      1320
     ctcgtcggcg gcctgcgcta ccaggatttc acccagcagg ccggcaaggg ccgccccttc      1380
     aacctcaaca ccgacgtctc gggcgggcgc gtggtgccgc gggtcggggc cgtctatctc      1440
     ctcaaccccg agacctccgt ctacgcctct tatagcgaga ccttccggcc gaattcctcg      1500
     atcgcgagct atatcggcgc tcttccccct gagtccggcg aggcggtgga ggtcggcatc      1560
     aaggtccaga ccgagggcat caccgctacg gcagccttct acgacatcgt caagagcaat      1620
     gtgctctaca ccgagaccgt caacggcatc agcgtcagcc gcacggccgg ccgggttggc      1680
     tcgcgcggct tcgaagtgga catcgccggc cagatcgcgc cggactggag cgtgatcgcc      1740
     acctacgcct atacggacgc ggtggtcctc gccgatccgc tgctcaccgg caagcgcctc      1800
     accaacgtgg cgccgcagac cgcctccctc tgggtcaccc acgatttcgg catcgtcggc      1860
     gacgggcgcc tgcgggcggg cgcgggagcg cgctacgtcg gctaccggcc gggcgacgcg      1920
     gtgaacagct tcaagctgcc ggactacgcg gtggtggacg ctttcgtcgc ctacgacacc      1980
     gtggtcgccg ccctgccgac gacgctccag ctcaacatcc gcaacctgct cgacacgacc      2040
     tactacacgt cctcgatcgg cacgaacaat ctcggggtgg aggtcggcga gccgttccag      2100
     gtcctggcct cggcgcgggt gagcttctga                                       2130
//

If you have problems or comments...

PBIL Back to PBIL home page