(data stored in ACNUC7421 zone)

EMBL: CP001349.PE50

CP001349.PE50        Location/Qualifiers
FT   CDS_pept        complement(57500..58363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0051"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: met:M446_0051
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55102"
FT                   /db_xref="GOA:B8IU57"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU57"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACL55102.1"
FT                   /translation="MPWLDGQLHDGPIAPFDLTDRGLLLGDGVFDTALVLNGRVVFEAA
FT                   HVGRLVGSAAALGFALEPKTVRAAMRAMAEGQTRAALRTTATRGSGPRGLRPPLEPHPR
FT                   LLASAAPLHGPGSAFAPLSLHLTGIRRNDTSPASRHKTLGYLDAVLAAAEAARVGCDEA
FT                   MFLNTSGQVACAGTGNLFAVFGEALVTPPLADGVLAGIVRGWILAEAPGLGLSVAERSI
FT                   GPADLAEADALLVTNSLRLIAPVRALDARSYPGDHPTARRLADALRAAIAAETGRDPAP
FT                   LGRDLA"
     atgccgtggc ttgatgggca gttgcatgac gggccgatcg cgcccttcga cctcaccgat        60
     cgcggcctcc tcctcggcga cggcgtcttc gacaccgcgc tcgtcctgaa cggccgcgtc       120
     gtcttcgagg cagcgcatgt cggccggctc gtcggctcgg ccgccgccct cggcttcgcg       180
     ctcgagccta agaccgtcag ggcggccatg cgggcaatgg ccgagggcca gacgcgagcg       240
     gccttgcgca ccaccgcgac ccggggcagc ggcccaaggg gcctgcgccc gccgcttgag       300
     ccccacccgc ggctgctcgc atcggccgcc ccgctgcacg gccccggctc cgccttcgcg       360
     ccgctctcgc tccacctcac gggcatccgc cgcaacgaca cctcgccggc ctcccgccac       420
     aagacgctgg gctatctcga cgcggtgctc gccgccgcgg aggcggcccg ggtgggctgc       480
     gacgaggcga tgttcctcaa cacaagcggg caggtggcct gcgccggcac cggcaatctg       540
     ttcgcggtct tcggcgaagc gctcgtcacc ccgccgctcg ccgacggggt gctggccggc       600
     atcgtccggg gctggatcct ggcggaggcg ccgggtctcg gactgtcggt ggcggaacgc       660
     tcgatcgggc ccgcggatct cgccgaggcc gacgcgctcc tcgtcaccaa ttccttgcgc       720
     ctgatcgcgc cggtgcgggc gctcgacgct cgatcctatc cgggcgacca cccgaccgca       780
     cggcgcctcg cggatgcgct gcgtgcggcc atcgcggccg agaccggccg cgatcccgcc       840
     ccgctcggga gagatctggc ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page