(data stored in ACNUC7421 zone)

EMBL: CP001349.PE500

CP001349.PE500       Location/Qualifiers
FT   CDS_pept        complement(577100..577954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0511"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; KEGG: met:M446_1620
FT                   prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55552"
FT                   /db_xref="GOA:B8ICG4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG4"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /protein_id="ACL55552.1"
FT                   /translation="MTRTISYQGEPGANSHIICAEAYPDWTPLPCATFEDALTAVSDGT
FT                   ADLGMIPIENSIAGRVADIHHLLPASGLHIVGEQFLPIHFQLMALPGADPEKIRTVYSH
FT                   VHALGQCRKVIRRRGLKAVVAADTAGAAREVALSGDPTRASLSPRLAAEIYGLSIIEED
FT                   VEDEAHNTTRFVVLAREPSPPPPESGPTVTSFVFRVRNLPAALYKALGGFATNGVNMTK
FT                   LESYMVEGQFTATQFYAEVDGHPEEAPLRRALDELSFFSRELRIIGTYPAHPFRESTRL
FT                   VAE"
     atgaccagga cgatctccta ccagggcgag cccggcgcga actcgcacat catctgcgcc        60
     gaggcctatc cggactggac gccgctgccc tgcgccacct tcgaggatgc gctgaccgcg       120
     gtctcggacg gcaccgccga tctcggcatg atcccgatcg agaattccat cgcgggccgc       180
     gtggcggaca tccatcacct gctgccggcc tccggcctgc acatcgtcgg cgagcagttc       240
     ctgccgatcc acttccagct gatggcgctg ccgggcgccg acccggagaa gatccgcacg       300
     gtctacagcc acgtccacgc cctcggccag tgccgcaagg tgatccgccg ccgcgggctg       360
     aaggccgtgg tggccgccga cacggcgggc gccgcccgcg aggtggcgct gagcggcgac       420
     ccgacccgcg ccagcctctc gccgcggctc gccgccgaga tctacggact gagcatcatc       480
     gaggaggacg tggaggacga ggcccacaac accacccgct tcgtggtgct cgcccgcgag       540
     ccgtcaccgc ccccgcccga aagcgggccg accgtgacga gcttcgtgtt ccgggtccgc       600
     aacctgccgg ccgcgctcta caaggcgctc gggggcttcg cgacgaacgg cgtcaacatg       660
     acgaagctcg agagctacat ggtcgagggc cagttcaccg cgacgcagtt ctacgccgag       720
     gtggacggcc atcccgagga ggcgcccctg cgccgcgccc tcgacgagct ctccttcttc       780
     tcccgcgagc tgcgcatcat cggcacctat ccggctcacc ccttccgcga gagcacgcgg       840
     ctcgtcgccg agtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page