(data stored in ACNUC7421 zone)

EMBL: CP001349.PE501

CP001349.PE501       Location/Qualifiers
FT   CDS_pept        complement(578082..578825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0512"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; KEGG: met:M446_1619
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55553"
FT                   /db_xref="GOA:B8ICG5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICG5"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ACL55553.1"
FT                   /translation="MSDPLILIPARLGATRLPDKPLADICGEPMIVHVWRRAIAAGLGP
FT                   VVVCTDAPTVVAAVEAVGGLAVLTRPDHPSGSDRLAEALGIIDPEGRHDVVVNLQGDLP
FT                   TIDPGIVAAAVTPLADRAVDIATLCAVITRDEERTEPSVVKLVGSPITPTRLRALYFTR
FT                   ATAPWGEGPLYHHIGLYAYRRRALERFVSLSPSVLERREKLEQLRALEAGMRIDAVVVD
FT                   DVPLGVDTPHDLDRARAVMAARRLN"
     atgtccgatc ccctgatcct gatccccgcc cgcctcggcg ccacacgcct gccggacaag        60
     ccgctggcgg atatctgcgg cgagccgatg atcgtgcatg tctggcgccg cgccatcgcg       120
     gccggcctcg gccccgtggt ggtctgcacc gatgcgccga cggtcgtggc ggcggtggag       180
     gcggtcgggg ggctcgcggt gctgacgcgg cccgaccatc cttccggctc cgatcgcctc       240
     gccgaggccc tcggcatcat cgaccccgag ggccgccacg acgtggtggt gaacctgcag       300
     ggcgacctgc cgacgatcga tcccggcatc gtcgcggccg ccgtgacgcc gctcgccgac       360
     agggcggtgg acatcgccac cctctgcgcg gtgatcaccc gcgacgagga gcggaccgag       420
     ccgagcgtgg tcaagctcgt gggctcgccg atcacgccga cccggctgcg cgccctctac       480
     ttcacccgcg ccaccgcccc ctggggcgag gggccgctct accaccatat cggcctctac       540
     gcctatcgtc gccgggccct ggagcgcttc gtctccttga gcccgagcgt gctggagcgg       600
     cgcgagaagc tcgagcagct gcgggccctc gaagccggca tgcggatcga tgcggtggtg       660
     gtcgacgacg tgccgctcgg cgtcgacacc ccccacgacc tcgaccgcgc ccgcgccgtg       720
     atggcggcgc ggcgcctcaa ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page