(data stored in ACNUC7421 zone)

EMBL: CP001349.PE502

CP001349.PE502       Location/Qualifiers
FT   CDS_pept        579133..579675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0513"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: met:M446_1618
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55554"
FT                   /db_xref="GOA:B8ICG6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG6"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACL55554.1"
FT                   /translation="MDSFELNKVAGAVLGTLLFAMGTGFLAELIYKPKPAGDHGYPLPA
FT                   AQEEPAGGGAAEAAKEEPLPVRLASADAAKGQSAAKKCAACHSFDKGGPNKVGPNLWGI
FT                   VGRPKGSHEGFNYSAAMKAKGGDWSYDDLDHFIHAPKGFVSGTIMAFAGVPSGAERADI
FT                   LAYLKTLSDKPVDFPKP"
     atggattcct tcgagcttaa caaggtcgcc ggtgccgtgc tcggcacgct gttgttcgcg        60
     atgggcacgg gcttcctcgc cgagctgatc tacaagccga agcccgcggg ggatcacggc       120
     tacccgctgc ccgcggccca ggaggagccg gccggcgggg gggccgccga agccgccaag       180
     gaggagcccc tgccggtgcg cctcgcgagc gcggatgcgg ccaagggcca gtcggccgcc       240
     aagaagtgcg ccgcctgcca cagcttcgac aagggcggcc cgaacaaggt cggcccgaac       300
     ctctggggca tcgtcggccg gccgaagggc agccacgagg gcttcaacta ctcggccgcc       360
     atgaaggcca agggcggcga ttggtcctat gacgacctcg accatttcat ccacgcgccg       420
     aagggcttcg tgtcgggcac gatcatggcc ttcgcgggcg tgccctcggg cgccgagcgc       480
     gccgacatcc tggcctacct gaagacgctc tcggacaagc cggtggactt ccccaagccc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page