(data stored in ACNUC7421 zone)

EMBL: CP001349.PE503

CP001349.PE503       Location/Qualifiers
FT   CDS_pept        579903..581756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0514"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1616 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55555"
FT                   /db_xref="GOA:B8ICG7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55555.1"
FT                   /translation="MIARRLAALALVCLTALPATAAEAPWRHGLSLLGTPKYPADFTHF
FT                   AYANPEAPKGGLLRLGFQGSFDNLNLVVAGVKGDLESEIPIIYDTLTTEAGDEPFTSYG
FT                   LLAESVQVAEDLGSVTYRLRPQAKWHDGAPVTPADVVFSFGVLKENSPQYAFYYHNVAK
FT                   AEAVGEREVRFTFSESGNRELPQIVGQMPVLPKHWWEGKDANGRPRNPTETSLEIPLGS
FT                   GPYRVARVEAGRTITYERVPDYWGRDIPVNKGRYNFDTLRNEYYRDATVLIEAFKADQF
FT                   DWRTENIARNWATAYDGFPAVREGRILKEEFPSRGSGIMQCFTFNMRRQKFADARVRRA
FT                   FNLAFDFEEMNRTLFYGLYKRIDSYFFGTELASSGLPEGREREILESVKDKIPAQVFTE
FT                   PYRNPVGGSPEAQRANLREAVRLLQAAGYTQRNGQMVEAATGQPLTVEFLGYDNSAERI
FT                   VLPYKQQLERLGIRVSLRIVDPAQYQNLVRSFDFDALALNSWPESLSPGNEQRDFWGSA
FT                   AADRPGSRNLAGIKDAGVDALIDKVIFASDRAELVAATRALDRVLLAHDYVVPQWAAGV
FT                   TRTLRWNRFSRPATLPQYGGSGFPWTWWYDQALAARTGVAR"
     gtgatcgccc gccgcctcgc cgcgctcgct ctcgtttgcc tcacggcgct ccccgccact        60
     gccgcggaag cgccctggcg ccatggcctc tcgctgctcg gcacgccgaa atacccggcc       120
     gacttcacgc atttcgccta tgccaacccg gaggcgccca agggcggcct gctgcggctc       180
     ggcttccagg gatccttcga caacctgaac ctcgtcgtcg cgggggtgaa gggcgacctc       240
     gagagcgaga tcccgatcat ctacgacaca ctgacgacgg aggcgggcga cgagcccttc       300
     acctcctatg ggctgctcgc cgagagcgtg caggtggccg aggatctcgg cagcgtcacc       360
     taccgcctgc gcccgcaggc caagtggcat gacggcgcgc cggtgacgcc cgccgacgtg       420
     gtcttctcct tcggcgtgct gaaggagaac agcccgcaat acgccttcta ctaccacaac       480
     gtggccaagg ccgaggcggt gggcgagcgc gaggtgcgct tcaccttctc ggagagcggc       540
     aaccgggagc tgccgcagat cgtcggccag atgcccgtcc tgcccaagca ctggtgggag       600
     ggcaaggacg cgaatggccg cccgcgcaac ccgaccgaga ccagcctcga gatccccctc       660
     ggctccggcc cctaccgggt ggcgcgggtc gaggccgggc gcaccatcac gtacgagcgg       720
     gtgcccgact attggggccg cgacatcccg gtgaacaagg gccgctacaa cttcgacacg       780
     ctgcgcaacg agtactatcg cgacgcgacc gtgctgatcg aggccttcaa ggccgaccag       840
     ttcgactggc gcaccgagaa catcgcccgc aactgggcca ccgcctatga cggctttccg       900
     gccgtccggg agggccggat cctcaaggag gaattcccct cccgcggcag cggcatcatg       960
     cagtgcttca ccttcaacat gcgccgccag aaattcgccg atgcgcgggt gcgccgggcg      1020
     ttcaacctcg ccttcgattt cgaggagatg aaccgcaccc tgttctacgg gctctacaag      1080
     cggatcgatt cctacttctt cggcaccgaa ctcgcctcct ccggcctgcc ggaagggcgc      1140
     gagcgcgaga tcctggagag cgtgaaggac aagatcccgg cccaagtctt caccgagccc      1200
     taccgcaatc ccgtgggcgg cagccccgag gcgcagcgcg ccaacctgcg cgaggcggtg      1260
     cgcctcctcc aggcggcggg ctatacgcag cgcaacgggc agatggtcga ggcggcgacg      1320
     ggccagccgc tcaccgtcga gttcctcggc tacgacaact cggccgagcg gatcgtgctg      1380
     ccctacaagc agcaattgga gcgcctcggc atcagggtgt ccctgcgcat cgtcgatccg      1440
     gcccagtacc agaacctggt gcgcagcttc gacttcgacg cgctggcgct gaattcctgg      1500
     cctgagtcgc tctcgcccgg caacgagcag cgcgacttct ggggctcggc cgccgccgac      1560
     cggccgggct cgcgcaacct cgcgggcatc aaggatgcgg gcgtcgacgc cctcatcgac      1620
     aaggtgatct tcgcgagcga tcgggcggag ctcgtcgccg cgacgcgggc gctcgaccgc      1680
     gtgctcctcg cccacgacta cgtggtgccg caatgggcgg ccggggtcac ccgcaccctg      1740
     cgctggaacc gcttcagccg ccccgccacc ctgccgcaat acgggggctc cggcttcccc      1800
     tggacatggt ggtacgacca ggcgctcgcc gccaggacgg gggtggcgcg atga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page