(data stored in ACNUC7421 zone)

EMBL: CP001349.PE504

CP001349.PE504       Location/Qualifiers
FT   CDS_pept        581753..583633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0515"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1615 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55556"
FT                   /db_xref="GOA:B8ICG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55556.1"
FT                   /translation="MSATRRTLLSLAAGAALAGALPRPPRAQSGPQAPDAQADERHGLS
FT                   SFGELKYPRDFQRFDYVEPMAPRGGTFSAQIATTTGNQAFETFNTLNIYVLKGDGAAGM
FT                   DLTFDSLMTRALDEPDALYGLVARSVRVSPDGLTYRFALRPQARFHDGSRLTARDVAFS
FT                   IRTLKEKGHPRISQVLRDVADAVAEGDEAVSVTFAAGRSRDLPLIVAELPIFSEAYYGG
FT                   HDFEASTLEAPLGSGPYQVARFEVGRFIAFERVRDYWGADLPVNVGQNNFDEIRFEYFR
FT                   DRDVAFEAFKAGAFTWREEFTSRVWATGYDFPAAQEGRVKRETVPDATPSGTQGWWFNT
FT                   RRPIFKDPRIREAIGLAFDFEWSNQNLMYGAYRRTASFFENSDLKAEGPPGPEELALLE
FT                   PFRGRVPDEVFGPPWSPPRSDGSGQDRALLRRADALLREAGCTRDGGQLRLPDGQPLAF
FT                   EFLDSNPVFQPLVQPFIKNLGLLGIRATSRIVDPAQYQARLKDFDFDVVSARFGGSLTP
FT                   GAGLREVYGSRSAATPGSQNLAGIADPAVDALLDRVATAATRAELTVACRALDRCLRAG
FT                   RYWVPMWYSASHRLALWDIYGRPAELPKYGLGAPAIWWHDAARARRIGRG"
     atgagcgcga cccgccgcac gctcttgagc ctcgcggccg gcgccgccct cgcgggggcc        60
     ctcccccgcc caccgcgcgc ccaatcgggc ccccaggcgc ccgacgccca ggcggacgag       120
     cgccacggcc tgtcgagctt cggcgagctg aaataccccc gcgacttcca gcgcttcgac       180
     tatgtcgagc cgatggcgcc gcgcggcggc accttctcgg cgcagatcgc caccaccacc       240
     ggcaaccaag ccttcgagac cttcaacacg ctcaacatct acgtgctgaa gggcgacggt       300
     gcggccggca tggacctcac cttcgacagc ctgatgaccc gggccctcga cgagcccgac       360
     gcgctctacg gcctcgtcgc ccgctcggtc cgggtgagcc cggacgggct cacctaccgc       420
     ttcgcgcttc gcccgcaggc gcgcttccac gacggctcgc gcctgaccgc ccgggacgtc       480
     gccttctcga tcaggaccct caaggagaag ggccacccgc ggatctcgca ggtgctgcgg       540
     gacgtggccg acgcggtcgc ggagggcgac gaggcggtca gcgtcacctt cgcggccggg       600
     cgcagccgcg acctgccgct catcgtggcc gaactgccga tcttctcgga agcctattac       660
     ggcggacacg acttcgaggc ctcgacgctg gaggcgccgc tcggctcggg cccctatcag       720
     gtggcgcggt tcgaggtcgg gcgtttcatc gccttcgaac gggtgcgcga ctattggggc       780
     gccgacctgc cggtgaatgt cggccagaac aacttcgacg agatccgctt cgagtatttt       840
     cgcgatcgcg acgtcgcctt cgaggcgttc aaggccgggg ccttcacctg gcgggaggaa       900
     ttcacctcgc gggtctgggc cacgggctac gacttcccgg ccgcccagga gggccgggtc       960
     aagcgcgaga ccgtaccgga cgccaccccg tcggggacgc aaggctggtg gttcaacacc      1020
     cgccggccga tcttcaagga tccgcggatc cgcgaggcga tcggcctcgc cttcgacttc      1080
     gagtggtcga accagaacct gatgtacggc gcctatcgcc gcacggcgtc gttcttcgag      1140
     aattcggacc tgaaggcgga gggcccgccc gggcccgagg agctggcgct gctcgaaccc      1200
     ttccggggcc gggtgccgga cgaggtgttc ggcccgccct ggtcccctcc ccgttcggac      1260
     gggtcgggcc aggaccgggc gctgctgcgc cgtgccgatg cgctcctgcg cgaggccggc      1320
     tgcacccgcg acggcggcca gctcaggctg ccggacgggc agcccctcgc cttcgagttc      1380
     ctcgattcga acccggtctt ccagccgctg gtgcagccct tcatcaagaa tctcgggctt      1440
     ctgggcatcc gggcgacgtc gcggatcgtc gatccggccc agtaccaggc gcggctcaag      1500
     gatttcgact tcgacgtggt gtcggcccgt ttcggcggct cgctgacgcc gggcgcgggc      1560
     ctgcgggagg tctatggcag ccgcagcgcc gcgacgcccg gctcccagaa cctcgccggg      1620
     atcgccgatc cggcggtcga cgcgctgctc gaccgcgtcg ccaccgcggc gacgcgggcg      1680
     gagctgaccg tggcctgccg ggccctcgac cgctgcctgc gggcggggcg ctactgggtg      1740
     ccgatgtggt actccgcctc gcaccggctc gccctctggg acatctatgg ccgcccggcg      1800
     gagctgccga aatacggcct cggcgccccg gcgatctggt ggcacgacgc cgcccgggcg      1860
     cggcggatcg gacgcgggtg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page