(data stored in ACNUC7421 zone)

EMBL: CP001349.PE505

CP001349.PE505       Location/Qualifiers
FT   CDS_pept        583638..584741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0516"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1614
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55557"
FT                   /db_xref="GOA:B8ICG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55557.1"
FT                   /translation="MANYILRRLLLMIPTILGIMLISFVIVQFAPGGPVERVLAQLQGQ
FT                   NTAMSRVSGSSGDLGAPASGPRGGGETNSRYRGAQGLDPAFIKRLEQQFGFDKPAHERF
FT                   AKMIWDYARFDFGKSYFRDVSVLQLIREKLPVSITLGLWMTLISYAVSIPLGIRKAVRD
FT                   GSPFDVWTSGVVIVGYAIPGFLFAILLIVLFSGGSFLQIFPLRGLTSEGWQSFPLWQKV
FT                   TDYLWHITLPILSMALGAFATSTLLTKNSFLDEIRKQYVLTARMKGLSERQVLYGHVFR
FT                   NAMLIVVAGFPGAFISAFFAGSLLIETIFSLDGLGLLSFESIVNRDYPVVFANLYIFSL
FT                   LGLVVNLISDLTYSWIDPRIDFESRAA"
     atggcgaact acatcctccg ccgcctgctc ctgatgatcc cgaccatcct ggggatcatg        60
     ctgatctcct tcgtgatcgt ccaattcgcg ccgggcggcc ccgtggagcg cgtgcttgcc       120
     cagctccagg gccagaacac cgcgatgtcg cgcgtctcgg gcagttcggg cgacctcggc       180
     gcgccggcat ccggaccgcg cggcggcggc gagacgaatt cccgctaccg cggcgcgcag       240
     gggctcgatc ccgccttcat caagcgcctg gagcagcagt tcggcttcga caagccggcc       300
     cacgagcgct tcgccaagat gatctgggac tacgcccgct tcgacttcgg caagagctat       360
     ttccgcgatg tctcggtgct gcagctcatc cgcgagaagc tgccggtctc gatcacgctg       420
     ggcctgtgga tgacgctgat ctcctacgcg gtctcgatcc cgctcggcat ccgcaaggcg       480
     gtgcgggacg gctcgccctt cgacgtctgg acctcggggg tcgtgatcgt gggctacgcg       540
     attccgggct tcctgttcgc gatcctcttg atcgtgctgt tctcaggcgg ctccttcctg       600
     cagatcttcc cgctgcgggg cctcaccagc gagggctggc agagcttccc gctctggcag       660
     aaggtgacgg attacctctg gcacatcacg ctgccgatcc tgtcgatggc gctcggcgcc       720
     ttcgccacct cgacgctgct caccaagaac tccttcctcg atgagatccg caagcaatac       780
     gtgctcaccg cgcgcatgaa gggtctgtcc gagcgacaag tgctctatgg gcacgtcttc       840
     cgcaacgcca tgctgatcgt ggtggcgggc tttccgggcg ccttcatctc ggccttcttc       900
     gccggctcgc tcctgatcga gaccatcttc tccctggacg ggctcggcct cctctccttc       960
     gagtcgatcg tgaaccgcga ctacccggtc gtgttcgcga acctctacat cttctcgctg      1020
     ctcgggctgg tggtgaacct gatctcggac ctcacctaca gctggatcga cccgcggatc      1080
     gacttcgaga gccgggcggc ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page