(data stored in ACNUC7421 zone)

EMBL: CP001349.PE506

CP001349.PE506       Location/Qualifiers
FT   CDS_pept        complement(584824..585378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55558"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH0"
FT                   /inference="similar to AA sequence:KEGG:M446_2034"
FT                   /protein_id="ACL55558.1"
FT                   /translation="MAHERTASVFFFAPFVSSTMAVEPDWIDYNGHLNMAYYHVLFDRA
FT                   VDEAFGIVGLGPDYVVERQASYFAAEVHVRYRRELTRDDRVRVTLQLIDFDEKRLHFYS
FT                   EIRHAQDGWVAASSENMSLHVDATTRRVSSFPDDIMANLAVMKASHARLPRPDDLGRVM
FT                   SIPCRGRGQNGPVALTAGTRH"
     atggcacacg agcgaaccgc atcggtgttc ttcttcgccc ccttcgtctc atcgacgatg        60
     gcggtcgagc cggactggat cgactacaat ggccatctga acatggccta ttatcacgtg       120
     ttgttcgacc gcgcggtcga tgaagccttc ggcatcgtcg gattggggcc ggactacgtg       180
     gtggagcgtc aggcaagtta ctttgccgcc gaagtccatg tgcggtaccg gcgagagttg       240
     acgcgtgacg atcgcgtgcg ggtgacgctg cagttgatcg acttcgacga gaagcggctg       300
     cacttctatt ccgagatccg ccacgcgcag gacggctggg tcgcggcctc gtccgagaac       360
     atgtcgctcc acgtcgatgc gacgacgcgg cgggtgtcgt ccttcccgga cgatatcatg       420
     gcgaatctcg ccgtgatgaa ggccagccac gcacgcctac cgcggccgga cgatctcggc       480
     cgcgtgatga gcatcccgtg ccgcgggcgc ggccagaacg ggccggtcgc cctgacggcc       540
     ggcacgcggc actga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page