(data stored in ACNUC7421 zone)

EMBL: CP001349.PE507

CP001349.PE507       Location/Qualifiers
FT   CDS_pept        585637..587055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0518"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   met:M446_2035 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55559"
FT                   /db_xref="GOA:B8ICH1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL55559.1"
FT                   /translation="MNAPSPAPLRERPSQETVAAVTAALAARFGNRLVTSQAVREQHGS
FT                   TLTWVPNQPPDAVVFAQSTEEVQEIVRICAAHRMPVVAFGTGTSLEGHVNAPFGGVSVD
FT                   LSQMNRVLAVHAEDLDCVVQPGVTRKALNEHLRDQGLFFPIDPGADASLGGMAATRASG
FT                   TNAVRYGTMKDNVLALTAVLPSGEIVRTGSRARKSSAGYDLTRLLVGSEGTLGIITELT
FT                   LRLSGIPEAISAGICPFPTIKAACDAVIMTIQSGLPVARIELLDEVQVAACNAHSKLTL
FT                   PETPLLLVEFHGSEAGVAEQAERFGEITAEFGGGPYEWATKAEERSRLWQARHDVYWAA
FT                   SGMRPGAKVIATDVCVPISRLAECVDETKRDIVASGIVAPIAGHVGDGNFHTSPLVMMD
FT                   DPDEIARVTAFIERLVARAIAMEGTCTGEHGIGQKKMRFMEIEHGSAALELMRSLKRTI
FT                   DPDNIMNPGKVLAV"
     atgaatgcac ccagtcccgc cccgctgcgc gagcgcccga gccaggagac ggtggcggcg        60
     gtgaccgccg cgcttgccgc ccgattcggc aaccgcctcg tcacctcgca ggccgtgcgt       120
     gagcagcacg ggagcaccct gacctgggtg ccgaaccagc cgccggacgc ggtggtcttc       180
     gcgcagagca ccgaggaggt gcaggagatc gtgcggatct gcgccgcgca ccggatgccg       240
     gtggtcgcct tcggcaccgg cacctcgctc gagggccacg tgaatgcccc cttcggcggc       300
     gtgtcggtcg acctctcgca gatgaaccgg gtgctcgccg tccatgcgga ggatctcgac       360
     tgcgtggtgc agccgggcgt gacccgcaag gcgctgaacg agcatctgcg cgaccagggg       420
     ctgttcttcc ccatcgatcc cggcgccgac gcctccctgg gcggcatggc ggcgacgcgg       480
     gcctcgggca ccaatgcggt gcgctacggg accatgaagg acaacgtgct ggcgctgacc       540
     gcggtgctcc cgagcggcga gatcgtccgc accggctcgc gggcgcgcaa gagctcggcg       600
     ggctacgacc tgacgcggct cctcgtcggc tcggagggga cgctcggcat catcaccgag       660
     ctgaccctgc ggctctctgg gattccggag gcgatctcgg ccggcatctg cccgttcccg       720
     accatcaagg cggcctgcga tgcggtgatc atgacgatcc agtccggcct gccggtggcg       780
     cggatcgagc tcctcgacga ggtccaggtc gcggcctgca acgcccattc gaagctcacc       840
     ctgcccgaga cgccgctgct cctggtggag ttccacggct cggaggccgg ggtcgccgag       900
     caggcggagc gcttcggcga gatcaccgcg gagttcggcg gcggccccta cgaatgggcg       960
     acgaaggccg aggagcgctc gcgcctctgg caggcccgcc acgacgtcta ctgggcggcg      1020
     agcgggatgc gcccgggcgc caaggtgatc gccacggatg tctgcgtgcc gatctcgcgg      1080
     ctggccgaat gcgtggacga gaccaagcgc gacatcgtcg cgagcggcat cgtcgcgccg      1140
     atcgcgggcc atgtggggga tggcaacttc cacacctcgc cgctcgtgat gatggacgat      1200
     cccgacgaga tcgcccgcgt caccgccttc atcgagcgcc tcgtcgcgcg ggccatcgcc      1260
     atggagggca cctgcacggg cgagcacggc atcggccaga agaagatgcg cttcatggag      1320
     atcgagcacg gctcggccgc gctcgagctg atgcgcagcc tcaagcgcac catcgatccg      1380
     gacaacatca tgaatccggg caaggtgctg gcggtctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page