(data stored in ACNUC7421 zone)

EMBL: CP001349.PE508

CP001349.PE508       Location/Qualifiers
FT   CDS_pept        complement(587088..588479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0519"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_2036 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55560"
FT                   /db_xref="GOA:B8ICH2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH2"
FT                   /inference="similar to AA sequence:KEGG:M446_2036"
FT                   /protein_id="ACL55560.1"
FT                   /translation="MPTILHRRDTLLLTGGLLLLALAALVLVLTRPTTLRVAVGPRDGV
FT                   EARLIEAYAEALARGQEDIRLKVVPFDDVRDSAAALQAGQADLAVVRPDVRLPENGLTL
FT                   AVLQDEALVVAAPAAAGITAFHELTGKRLGLVAHHGADQPFVTSLLTYYDLAQAPAERA
FT                   GAPGTVTLVPLRAEEITAALTSGRIDAVAVIAAPSSRRAGHVVRAVEAAAPDRSAVLVA
FT                   IPDGEAIIQRLPELQAMTIPAGTFGGRPKRPEEEVRTVGASYRLMARASLDRDTAARVT
FT                   QHLFELRSRLAARTTTANLMKAPDFDSSVAATSARLPNHPGAVDYFEREQQTFLQRYED
FT                   WIYLVAFFGGGLGSAGAWLGQRFAREKRARIDAVLDRLLSILSEARTAPDAATLDALAI
FT                   EIDGLVVDVVGHARSHATDIRTMSALILAVDAARAAVADCRRARDDGSARERIARVLTL
FT                   HAPGA"
     atgccgacga ttctccacag gcgcgatacc cttctgctga ccggcgggct cctgctcctc        60
     gcgctcgccg ccctcgtgct cgtgctcacg cggccgacga ccctccgggt ggcggtgggc       120
     ccgcgcgacg gggtcgaggc ccggctgatc gaggcctacg cggaggctct cgcccgcggc       180
     caggaggata tacgcctgaa ggtcgtcccg ttcgacgacg tgcgcgacag cgccgcggcg       240
     ctgcaggcgg gtcaggccga tctcgcggtg gtgcgtcccg acgtgcggct gcccgagaac       300
     ggcctcaccc tcgcggtgct gcaggacgag gcgctggtgg tcgccgcgcc cgccgccgcc       360
     ggcatcaccg cctttcacga actcacgggc aagcgcctcg gcctcgtcgc ccatcacggg       420
     gccgaccagc ccttcgtgac gagcctgctg acctactacg acctcgcgca ggcgccggcc       480
     gagcgggccg gggcgcccgg gacggtgacc ctggtgccgc tgcgggcgga ggagatcacc       540
     gccgcactga cgagcggccg gatcgacgcg gttgcggtga tcgccgcccc ctcgtcccgc       600
     cgggcggggc atgtggtccg ggccgtggag gccgcggcgc ccgaccggag cgccgtcctg       660
     gtggcgatcc cggacggcga ggccatcatc cagcgcctgc ccgagctcca ggccatgacg       720
     atcccggccg gcaccttcgg cgggcggccc aagcggcccg aggaggaggt gcgcacggtc       780
     ggcgcctcct accggctgat ggcccgcgct tccctcgacc gcgacaccgc cgcgcgggtc       840
     acccagcacc tgttcgagct gcgctcgcgg ctcgccgccc gcaccaccac cgccaacctg       900
     atgaaggcgc cggacttcga cagctccgtc gccgcgacca gcgcccggct gccgaaccat       960
     ccgggcgcgg tcgactattt cgagcgcgag cagcagacct tcctgcagcg ctacgaggat      1020
     tggatctacc tcgtggcctt cttcggcggc gggctcggct ccgcgggggc ctggctcggg      1080
     cagcgcttcg cccgcgagaa gcgcgcgcgc atcgacgcgg tgctcgaccg cctcctctcg      1140
     atcctgtcgg aggcccgcac ggccccggac gcggccaccc tcgatgcgct cgccatcgag      1200
     atcgacggcc tcgtggtcga cgtggtgggc catgcccgct cgcatgccac cgacatccgc      1260
     accatgagcg cgctcattct tgcagtggat gccgcccgcg ccgcggtggc ggattgccgg      1320
     cgggcccggg acgacgggag cgcgcgggag cgcatcgcgc gggtgctgac gcttcacgcg      1380
     cccggtgcct ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page