(data stored in ACNUC7421 zone)

EMBL: CP001349.PE509

CP001349.PE509       Location/Qualifiers
FT   CDS_pept        588495..589115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0520"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: met:M446_2037
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55561"
FT                   /db_xref="GOA:B8ICH3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH3"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACL55561.1"
FT                   /translation="MRVKTIEDASAIPAAHEDADRHGGMTALPISAASLERAALAYLER
FT                   YGASTDMLRRVLLRRVAGRCRLRGEDPADFAALVEAVVAKAGRAGLVDDTIFADAKVRT
FT                   LRRRGGSARAIHAKLAAKGVDRETVQAALAAHEADRGEDDEAAAARAYARRRRLGPWRR
FT                   AEERAEARMRDLAAMARAGFAPSLARRVIDGEGETGAAAPDRE"
     atgcgggtca aaaccattga agacgcctcc gcgatccctg cggcgcacga ggatgccgac        60
     cggcatggcg gaatgacggc gcttccgatc agcgcggcct ctctggagcg ggcggccctc       120
     gcctatctgg agcgctacgg cgcctcgacc gacatgctgc ggcgcgtgct gctgcgccgg       180
     gtcgccgggc gctgccgcct gcgcggcgag gatccggccg atttcgccgc cctggtggag       240
     gcggtggtcg cgaaggcagg ccgggccggc ctcgtggacg acacgatctt cgccgatgcc       300
     aaggtccgca ccttacgccg ccgcggcggc tcggcccggg cgatccacgc gaagctcgcg       360
     gcgaagggcg tcgatcgcga gaccgtgcag gcggccctcg ccgcgcacga ggccgacagg       420
     ggggaggacg acgaggccgc cgcggcccgg gcctatgccc gccgccgccg cctcggcccc       480
     tggcgccggg cggaggagcg ggcggaggcg cgaatgcggg atctggccgc gatggcccgg       540
     gcgggcttcg ccccctcgct cgcgcggcgg gtgatcgacg gcgagggcga gaccggagcc       600
     gctgcgcccg acagggagta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page