(data stored in ACNUC7421 zone)

EMBL: CP001349.PE51

CP001349.PE51        Location/Qualifiers
FT   CDS_pept        complement(58350..58955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0052"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   met:M446_0052 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55103"
FT                   /db_xref="GOA:B8IU58"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU58"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACL55103.1"
FT                   /translation="MILVIDNYDSFVFNVVRYFEELGAAVEVVRNDALDVRAIRARAPE
FT                   ALVISPGPCTPAEAGVSLEAVRALSGELPLLGVCLGHQCIGAAFGGRVERAGRPLHGQA
FT                   SPVTHDGRGLFRGLPSPMRVGRYHSLIVAPEPAMERILSVDAVSAEGEVMALSHRRHPT
FT                   FGIQFHPESVLTENGHAIFANFLALARAWREAPAHAVA"
     atgatcctcg tcatcgacaa ctacgattcc ttcgtcttca acgtggtgcg ctacttcgag        60
     gagctcggcg ccgccgtgga ggtcgtgcgc aacgacgccc ttgatgtgcg ggcgatccgg       120
     gcgcgggcgc ccgaggcgct ggtgatctcg cccgggccgt gcaccccggc ggaagccggc       180
     gtgtcccttg aggcggtgcg cgccctgtcg ggggagctgc cgctcctcgg ggtctgcctc       240
     ggccaccaat gcatcggcgc ggccttcggt ggccgcgtcg agcgggccgg ccggcccctg       300
     cacgggcagg cctcgcccgt gacccatgac gggcgcgggc tcttccgcgg cctgccctcg       360
     ccgatgcggg tcgggcgcta tcactccctc atcgtggccc cagagcccgc catggaacgg       420
     attctgagcg tcgatgccgt ctcggcggaa ggggaggtga tggcgctctc ccatcgccgc       480
     catcccacct tcggcatcca gttccacccg gaatcggtgc tgaccgagaa cggccacgca       540
     atcttcgcca atttcctcgc cctggcccgg gcgtggcgcg aggccccggc ccatgccgtg       600
     gcttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page