(data stored in ACNUC7421 zone)

EMBL: CP001349.PE510

CP001349.PE510       Location/Qualifiers
FT   CDS_pept        complement(589181..589444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH4"
FT                   /inference="similar to AA sequence:KEGG:M446_2038"
FT                   /protein_id="ACL55562.1"
FT                   /translation="MTGSERPTLGELFRIKAVTDHDLSAAVAAYFADPTPGPREIARGI
FT                   RIDVAAAVAAHDWARRIVEDEAIIERARRNAVRTAILHARPM"
     atgactggga gcgagcgccc gacgctgggc gagctgttca ggatcaaggc ggtgacggac        60
     cacgacctca gcgcggccgt ggcggcctat ttcgccgacc cgacaccggg gccgcgcgag       120
     atcgcgcgcg gcatcaggat cgacgtcgcc gcggccgtcg cggcacatga ttgggccagg       180
     cgcatcgtgg aggacgaggc gataatcgag cgggcccgcc gcaatgcggt caggaccgcg       240
     atcctccacg ctaggcccat gtga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page