(data stored in ACNUC7421 zone)

EMBL: CP001349.PE511

CP001349.PE511       Location/Qualifiers
FT   CDS_pept        complement(589592..589876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55563"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH5"
FT                   /inference="similar to AA sequence:KEGG:M446_2040"
FT                   /protein_id="ACL55563.1"
FT                   /translation="MSSVIATLVAQAIRHQDGQLRTPYGIEARDAEDLARAAIGAYGDA
FT                   LAAAGLAIVPLAAAERARGQESRDGRQVGGREILKARLRPYRSVGGRRL"
     atgagctctg tcatcgccac cctcgtggcg caggcgatcc ggcatcagga tggccagctc        60
     cgcaccccgt acgggatcga ggcccgtgac gcggaggatc tcgcgcgcgc cgcgatcgga       120
     gcctacgggg acgcgctcgc ggcggcgggg ctggcgatcg tgccgctcgc ggctgccgag       180
     cgggcgaggg gtcaggagag ccgggacggc cggcaggtgg ggggccgcga gatcctgaag       240
     gcgcggctgc gcccctaccg ctctgtcggg ggccgcaggc tatag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page