(data stored in ACNUC7421 zone)

EMBL: CP001349.PE512

CP001349.PE512       Location/Qualifiers
FT   CDS_pept        complement(590209..590736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0523"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   mex:Mext_1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55564"
FT                   /db_xref="GOA:B8ICH6"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH6"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACL55564.1"
FT                   /translation="MPDWRALFVPEHSLVEIALRGTIMYLALFVILRFVMQRQAGAVGL
FT                   ADLLVIVLIADVSQNAFSNEYKSLTEGVLLVLTIVGWNYGIDWLGYRFPAFERFITPRR
FT                   LPLVVDGEICWRNMRREMITHAELMSQLRQQGIEDPAMVRIASIEGDGRISVIRRDDDD
FT                   TGRDGDKRREVA"
     atgcctgact ggcgagccct gttcgtgccg gagcattccc tggtggaaat cgccctgcgc        60
     ggcaccatca tgtacctcgc cctcttcgtc atcctgcgct tcgtgatgca gcgccaggcc       120
     ggagcggtcg gcctggcgga cctgctggtg atcgttctga tcgcggacgt atcgcagaac       180
     gccttctcca acgagtacaa gtcgctcacg gaaggtgtgc tgctcgtcct gaccatcgtg       240
     ggctggaatt acggcatcga ttggctcggc taccggttcc cggccttcga gcgcttcatc       300
     acgccgcgac gattgccgct ggtcgtcgat ggcgagatct gctggaggaa catgcgccgg       360
     gaaatgatca cgcatgcgga gctgatgagc cagctccggc agcagggcat cgaggatccc       420
     gccatggtgc ggattgcatc catcgagggc gacggacgca tcagcgtgat ccggcgcgac       480
     gacgatgaca cggggaggga cggggacaag cgccgggagg tggcgtga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page