(data stored in ACNUC7421 zone)

EMBL: CP001349.PE513

CP001349.PE513       Location/Qualifiers
FT   CDS_pept        complement(591063..591482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55565"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH7"
FT                   /inference="similar to AA sequence:KEGG:M446_1067"
FT                   /protein_id="ACL55565.1"
FT                   /translation="MPIDLPREPFPPAVPFTSRLKLFATDMRLGVTGWRLDQARRRRDH
FT                   RGLLRHLEVWTTLQDRRAVYLGQRLPLAADRARDETCRRIRGIVHRIDRETRRLEWATG
FT                   RMQRAYLAQDQRAFSHAELLGQLACQRLQRLWTSL"
     atgccgatcg accttcctcg cgagcctttt cctccggcgg tcccgttcac cagcaggcta        60
     aaactcttcg ccaccgacat gcgcctgggg gtgaccggct ggcggttgga ccaagcccgg       120
     aggcggcgtg atcaccgcgg cctgttgcgt catctggagg tctggacgac cctgcaggac       180
     cgccgcgcgg tctatctggg ccagcgcctg cccctcgcag ccgacagggc ccgcgacgag       240
     acctgccgcc gtatccgtgg gatcgtgcac cggatcgacc gggagacccg tcgccttgaa       300
     tgggccacgg gccggatgca gcgggcctac ctggcgcagg atcagcgggc cttcagccac       360
     gccgagctgc tgggccagct cgcctgccag cggcttcaga ggctatggac ctccctgtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page