(data stored in ACNUC7421 zone)

EMBL: CP001349.PE516

CP001349.PE516       Location/Qualifiers
FT   CDS_pept        592994..594106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0527"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: met:M446_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI0"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACL55568.1"
FT                   /translation="MRGELHASPGQSNRLVSSFTVVCLSACLLADPVAAQDPSDPSGSP
FT                   VSATKSDSVAGGSLSMATIRVPQGERIVLPITNASTQNRNFRSIYMVGLPPGAMVSDNI
FT                   HDATITSESRTLDVSNWNLEGISLLLPDDIASRFPDPIVTSIVAILPRSEKAGSIRTET
FT                   LSTTVIIPEIKATKSPETVSTQPSAQPDNPPPPALTPQPASQPTPKDDKPETPWLNPKS
FT                   AEGKPKPDNTGEPTSAQLKQAPSTAEKTRDTAQDQATASSQAPDTAAQAGPTTARDAGE
FT                   SALAKSLTQRAQQALRLGNVSGARLLLQRAASSGDAEATFMLAQTYDESFLRHLGVRGL
FT                   KADPEQARTYYDAAARAGYAGIQRQAKSGR"
     atgcgagggg aactgcacgc ttcaccgggc cagagcaaca ggctcgtgtc atctttcacg        60
     gtggtttgct tgtctgcctg tcttcttgca gatccggtcg ccgcccaaga tccgtccgac       120
     ccctctggaa gcccggtctc ggcgacgaaa tcggacagcg ttgcaggcgg cagcctctcc       180
     atggcaacga tcagagtccc gcagggggag cgaatcgttc tgccgatcac caacgcatcc       240
     acgcagaatc gcaatttcag atcgatctat atggtcggtc taccacccgg cgccatggta       300
     tccgacaaca tccatgatgc aacgattacc agcgaaagcc gaacgctgga cgtcagcaac       360
     tggaatcttg aagggatttc attgcttttg ccggacgata tagcgtcacg ctttccggat       420
     cctatcgtga cgagcattgt cgccattctg ccgcgatcgg aaaaagccgg ttccataaga       480
     accgaaacgc tgtcgacgac agttatcatt cccgagatca aggcgacgaa atcacccgaa       540
     acggtgagca cgcagccgag cgctcaacca gacaatccac cacctccggc actcaccccg       600
     caacccgcgt cgcaacccac gccgaaagac gacaagcccg agactccctg gctcaatccc       660
     aaatccgccg aaggaaaacc gaaaccggac aacaccggcg agccaacctc ggcacaacta       720
     aaacaagccc cgagcacagc agagaaaaca cgggacaccg cgcaggatca ggcaaccgca       780
     tccagtcagg cccccgatac ggcggcacaa gccgggccga caacggctcg ggatgcaggc       840
     gagagcgccc tggccaagtc gctcactcag agagcgcagc aagcactccg acttggcaat       900
     gtgagcggag ccagattgct gctgcagaga gcggcgtcga gtggcgatgc cgaagccacg       960
     ttcatgctgg cgcagacata tgacgagagc ttcctgcggc atttgggagt ccgcggtctg      1020
     aaagccgatc cggaacaggc ccgcacctat tacgacgctg cagcccgcgc cggctatgcc      1080
     ggcattcaac gccaagcgaa atcgggcaga taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page