(data stored in ACNUC7421 zone)

EMBL: CP001349.PE517

CP001349.PE517       Location/Qualifiers
FT   CDS_pept        594136..595299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55569"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI1"
FT                   /inference="similar to AA sequence:KEGG:M446_3556"
FT                   /protein_id="ACL55569.1"
FT                   /translation="MDRKRARIFTTAALCVLSIGWTAGSVAVARDQTQSSNSATASDKL
FT                   ETEAAITDHMNSSTVSIITGTPGGTYFRIGADLAFVLDDDSKLRILPILGKGAGQNAYD
FT                   LRFLKGVDLAFLRTDTLEQLRQDKRLSRIEYHIHYIAKLFDDELHVIGPNDITDARQLA
FT                   GKKVTFDVKGSGTDYSGKAMFRNLGISVQAINVDQPTAFEMLRKGEVDAVVSVAAKPVA
FT                   VVANFDPADKFHLIPVKYSESINESYAPASISKKDYPKLIKDDGQVETLAVGTVLGVYN
FT                   HPKGSFRYKKLSRFVESFFSRFDEFLSPQRHPKWREVNLAAEVSGWTRFRPAQDWLDSQ
FT                   REHQVSSNDNLTKFLNEQQPGAATDKEELYQAYLKWRNARRNTTSGL"
     atggacagaa agcgcgccag gatcttcacg acggccgcct tgtgcgttct cagcatcggc        60
     tggacagccg gctcggtcgc agtcgcccgt gatcaaaccc agagttccaa cagcgccacg       120
     gccagcgaca agctcgaaac cgaggcggcc atcaccgatc acatgaattc ctccaccgtg       180
     tccatcatca ccggcacgcc gggaggcacc tatttccgca tcggggcaga tcttgccttc       240
     gtgctggacg acgacagcaa gctgcgcatc ctgccgatcc tgggcaaagg agccggccag       300
     aatgcctacg atctgcgctt tctgaaggga gtcgatctcg cgtttctgag aaccgatacg       360
     cttgagcagc ttcgacaaga caaacgcctc tccagaattg aataccacat tcactatatt       420
     gcaaagctgt tcgatgatga acttcatgtc attggaccga acgacatcac cgatgctcgg       480
     cagctggcgg gcaagaaagt gaccttcgac gtcaaaggga gcggcaccga ttacagcggc       540
     aaagcgatgt tccgcaacct tgggatttcc gtgcaggcaa tcaatgtcga ccaaccaacc       600
     gcatttgaga tgttgcgaaa gggcgaagtc gacgccgtcg tttcagtggc tgcaaagccg       660
     gtggccgtgg tcgcgaattt cgatccagcc gataaatttc acctcatccc ggtgaaatac       720
     tcggagtcga taaacgagtc ttacgcgcca gcatctatct caaagaagga ttatcccaag       780
     ctgatcaagg acgatgggca agtcgaaaca ctggcggtcg gcacggtgct cggtgtctac       840
     aaccacccga aaggatcctt ccgttacaag aaactgtctc gtttcgtgga atccttcttc       900
     agccggttcg acgagttcct ctccccgcag cgccatccga aatggcgcga ggtcaacctc       960
     gcggccgaag tgagcgggtg gacgcggttc cggcccgccc aggactggct cgacagccag      1020
     cgcgagcatc aggtttcatc caacgacaat cttaccaagt tcttgaacga gcagcagcca      1080
     ggtgcagcaa ccgacaagga agagctttat caggcctatt tgaaatggcg gaacgcccgt      1140
     cgaaacacga ccagcggcct gtag                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page