(data stored in ACNUC7421 zone)

EMBL: CP001349.PE518

CP001349.PE518       Location/Qualifiers
FT   CDS_pept        complement(595715..596212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55570"
FT                   /db_xref="GOA:B8ICI2"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI2"
FT                   /inference="similar to AA sequence:KEGG:M446_0955"
FT                   /protein_id="ACL55570.1"
FT                   /translation="MTAPPVPAHPKQDKAALLAAFYGYLGGRIDSVARRSSLLMAFLAS
FT                   FLGFAMSPLMKRDAASVSEKVEFVLSHPSLLIGVAGMIILLWSDLARVRRADDLFSRIA
FT                   FSDLDIGSLQDRYVGSQIDDLFRQMIANTRVVGEFLKRKIRLYNAGAILFAVSVSLYVI
FT                   GL"
     gtgaccgcac cgccagtccc tgctcatccg aagcaggaca aggccgcgct cctggccgcg        60
     ttctatggct atcttggtgg acggatcgac tcggtcgcac gccggtcttc tcttctgatg       120
     gccttccttg cctcgttcct cggcttcgcg atgtcgccct tgatgaaaag agacgccgct       180
     tcggtatccg agaaggtcga atttgttctc tctcatccat ctctactgat cggcgttgct       240
     ggaatgataa tattattatg gtccgatctg gcgagggttc ggagggcgga tgacctgttc       300
     agccggatag cgttctctga tctcgatatc ggaagtttgc aggacaggta cgttggctct       360
     cagatcgatg acctgttccg tcagatgatc gccaacacgc gcgtcgttgg cgaattcctc       420
     aaaaggaaaa tcaggctgta taatgcagga gccatccttt ttgctgtcag tgtctccctg       480
     tacgtgatcg ggttgtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page