(data stored in ACNUC7421 zone)

EMBL: CP001349.PE519

CP001349.PE519       Location/Qualifiers
FT   CDS_pept        complement(596261..597574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0531"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mrd:Mrad2831_2892 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55571"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55571.1"
FT                   /translation="MAVSMRRRSFLGGLAVSGVIGAGHLDVFARAWAETAEWKPEPNAS
FT                   LSLLRWKRFVPSEDEAFMRLVDAFIKATGVRISVTNESYDDIQPKASVAANTGQGPDLV
FT                   WGLYSFPALFPSKCLPVDDVAASLERKYGPWLPAAAAYGRIKGRWLAIPVAFTGSGINY
FT                   RISSLKKAGFSSFPANTEEFLELCKGLKRNNTPAGMALGHATGDANSWLHWALWAHGGG
FT                   LVDRNEKIVINSPETTKSLEYVKALYETFIPGTVSWNDSSNNKAFLAGDLHLTVNGVSI
FT                   YATAKTDNPRIAEDMDHAPLPIGPAGKPTEFTLAFPILAYTYTKAPNACKAFMAFMMDA
FT                   ANYCPWLNDAQGYLVEPLSAYPANPVWAKDPKLGAIAGGVKRSLAAGGSAPVSERIAAA
FT                   LAEFIVVDMYAGYCTGREDVRGAMRMAERSAQRIFRNA"
     atggccgtca gcatgcgacg tcgatctttc ttgggtggtc ttgcggtatc cggcgtgatc        60
     ggagccggcc acctcgacgt cttcgccagg gcttgggctg agacagccga gtggaagcct       120
     gaacccaatg cgagcctctc gctgctgcgg tggaagcggt tcgttccctc ggaggatgag       180
     gcattcatgc gactggtgga tgcgttcatc aaggcgaccg gcgtcagaat cagtgtcacc       240
     aacgagtcct atgacgacat ccagcccaag gcatccgtcg ctgcgaatac ggggcaagga       300
     cccgacctgg tttgggggct ctactccttc ccggcattgt ttccctccaa atgtctcccc       360
     gtcgacgacg tggctgcatc tctcgaaagg aagtatggtc cctggcttcc ggccgccgcg       420
     gcctatggaa ggatcaaagg caggtggctc gccataccag tggctttcac cggttcgggg       480
     atcaactatc gcatctcatc cctgaagaag gcgggattca gttcgtttcc ggccaacaca       540
     gaagagttcc tggaactctg taaaggtctg aagcggaata acactcctgc aggaatggcg       600
     ctgggccatg ccacgggcga tgcaaattcc tggctgcact gggccttgtg ggctcacggt       660
     ggcggcctcg tggatcggaa cgaaaagatc gtcatcaatt cgcccgagac caccaagtcg       720
     ctggaatatg tgaaagcgct ttatgaaacc ttcattccgg gcaccgtgtc ttggaatgat       780
     tcatcaaaca acaaggcttt tctggccggc gaccttcatc ttaccgtcaa tggcgtgtcg       840
     atctacgcaa cggcaaagac ggacaatcct cggatcgctg aggatatgga tcacgcgccg       900
     ctgccgattg gcccagcagg gaagccgacg gagttcaccc tggccttccc gatactcgcc       960
     tacacataca ccaaggcgcc aaacgcctgt aaggcattca tggcattcat gatggacgcc      1020
     gcgaattact gcccctggct gaacgatgct caaggctact tggtggaacc cctttcggct      1080
     tatccggcaa acccggtctg ggcgaaggat ccgaagctgg gcgcaatcgc cggaggcgtc      1140
     aaacgctctc tcgccgctgg tgggagtgcg cccgtgagcg agcggatagc agcggctctg      1200
     gctgagttca tcgtcgtcga catgtatgcc ggttactgca ctgggcgcga ggatgtgcga      1260
     ggggcgatgc ggatggcgga gcggtcagca caacgcattt tccgcaatgc gtga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page