(data stored in ACNUC7421 zone)

EMBL: CP001349.PE52

CP001349.PE52        Location/Qualifiers
FT   CDS_pept        complement(59059..60453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0053"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like; KEGG: met:M446_0053
FT                   para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55104"
FT                   /db_xref="GOA:B8IU59"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU59"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ACL55104.1"
FT                   /translation="MWTRPIPFLDPIAAAARLQGRPGLAFLDSAMRHPELGRYSYLAAD
FT                   PFLRFEVRGGRAFRDGAPLEGAPLAALRRLLAPYRAEPLPGLPPFQGGAIGYLAYDFGQ
FT                   SLERVAVPPRRASLCDDIALNLYGTLVAWDHREETCHLVATGFPETRGPARERHALACL
FT                   DAWEALLAGPEPVARPRSVPPLAWRSNFSAESYAAAVERVRAYIRAGDIYQANIAQRFT
FT                   AALPPGFDAFAFYRRLRARNAATFAAYLDFGRLKVASSSPERFLRLDGRQVETRPIKGT
FT                   APRSPDPAEDRARAEALLASDKERAENVMIVDLLRNDLSRICEPHSVSVPTLCGLETYA
FT                   GVHHLVSVVTGRLRAGADALDLLAATFPGGSITGAPKLRAMDIITEIEGDARELYCGNI
FT                   GWIGFDGRMDTNIAIRTVFMDEREAVLQAGGGITLLSDPVAEYEETLTKAERIFAAFTE
FT                   AAGDPT"
     atgtggaccc ggcccattcc cttcctcgac ccgatcgcgg ccgccgcgcg cctgcagggc        60
     cggccgggcc tcgcctttct cgacagcgcc atgcgccacc cggagctcgg gcgctattcc       120
     tacctcgcgg ccgatccctt cctgcgcttc gaggtccgcg gcggacgggc tttccgcgat       180
     ggcgctcccc tcgaaggcgc accgcttgcg gcgctgcggc gcctgctcgc gccctaccgg       240
     gccgagcccc tgcccgggct gccgcccttc cagggcggcg ccatcggcta tctggcctat       300
     gatttcgggc agagcctcga gcgcgtagcc gtgccgccgc ggcgcgccag cctgtgcgac       360
     gacatcgccc tgaacctcta cggcactctg gtcgcctggg accaccggga ggagacctgc       420
     cacctcgtcg cgacgggctt cccggagacg cgggggccgg cccgcgagcg gcacgccctg       480
     gcctgtctcg acgcctggga ggctctcctc gcgggtcccg aaccggtcgc ccgtccccgg       540
     agcgttccgc ccctggcgtg gcgctcgaac ttctcggccg aatcctacgc cgcggcggtc       600
     gagcgggtgc gcgcctatat ccgggccggc gacatctacc aggcgaacat cgcccagcgc       660
     ttcaccgccg cgctgccgcc cggcttcgac gccttcgcct tctaccgccg cctgcgggcg       720
     cgcaacgccg cgaccttcgc ggcctatctc gatttcggac ggctcaaggt ggcgtcgagc       780
     tcgcccgagc gcttcctgcg cctcgacggg cggcaggtcg agacgcggcc gatcaagggc       840
     accgcgcccc gctcgcccga tccggccgag gaccgggccc gggcggaggc gcttctcgcc       900
     agcgacaagg agcgggcgga gaacgtcatg atcgtcgatc tcctgcgcaa cgacctgtcg       960
     cggatctgcg agccgcacag cgtgagcgtc ccgacgctct gcggcctgga gacctatgcg      1020
     ggcgtgcacc atctcgtctc ggtggtcacg ggacgcctgc gcgcgggcgc cgatgccctc      1080
     gatctcctcg ccgcgacctt tccgggcggc tcgatcaccg gcgccccgaa gctgcgcgcc      1140
     atggacatca tcacggagat cgagggtgat gcgcgggaac tctactgcgg caacatcggc      1200
     tggatcggct tcgacggccg catggacacc aacatcgcga tccgcacggt gttcatggac      1260
     gagcgcgagg ccgtgctgca ggcgggcggc ggcatcacgc tcctctccga ccccgtcgcc      1320
     gagtacgagg agacgctgac caaggcggag cgcatcttcg ccgcgttcac ggaagcggcg      1380
     ggagacccca catag                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page