(data stored in ACNUC7421 zone)

EMBL: CP001349.PE520

CP001349.PE520       Location/Qualifiers
FT   CDS_pept        complement(597763..600867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0532"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bja:blr0277 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55572"
FT                   /db_xref="GOA:B8ICI4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI4"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACL55572.1"
FT                   /translation="MNLSAGFITRPIATALLMVAIVVLGAISYTLLPVAALPNIDTPTI
FT                   QVTAQLPGADPSTVASSVATQLERQFGQIPGLTQMTSSSGTGFTQITLQFDRSRTVDSA
FT                   AGDVQAAINATQGQLPAALLNPPTYHKTNPADTPILLIALTSDVLPIMTVSDYANSILA
FT                   QKISQIPGVGFVGVGGLQSPALRIQVNPAQLAAENLDFETVRSALANLTVLQPKGQLYG
FT                   PQQAVALQTNDQLMTVSGFEDAIVAYRNGAPIRVRDIGRVVKAPQDTTLAGWLNEKPAV
FT                   LLAVQRQPGANVTSTVAAIKAALPQLRASLPPGIQVEMVSDRTQTIQASLADVQFTLLL
FT                   TIALVVGVIALFLRKLWATVIPAIAVPISLVGTFAVMDALGYSLDNLSLMALTIAIGFV
FT                   VDDAIVMVENIVRHIEEGAAPLQAALKGAGEIGFTILSISISLIAVFIPFFLMGGVVGL
FT                   LFREFAVTVAVSILVSVVVSLTLTPMLCARLLPAGEGSPGRMSRLLEDFFTWLTRAYGR
FT                   GLRVALRHRFLTLMSFLATVALTGYLFVIIPKGFFPQQDTGLIIGISEAAQDVSPQGMR
FT                   QRQEAILAIASRDPAVASAVGYIGPGGPTVTENNGRVFITLKPEGERDVTADQVIVRLG
FT                   KALEQVQGITLYMQAAQDITIGSRLSKTQYQYTLTDVNLDELNLYAPKLLEALRRLPEL
FT                   TAVASDQQSTARTLTVEIDRAAASRLGIDPSLVDATLYDAFGQRHVARIYTALNQYYAI
FT                   LEVAPSYQLGPAALNRIYVRSQSGTSVPISQIARLVPGVAPAAVNHQGQFPSVTLSFNL
FT                   APGATIGAAVAAVQKATVDLHLPPSIATSFQGNAQAFQSSLGSTPPLILAALFAVYVIL
FT                   GMLYESTIHPLTILSTLPSAGLGALATLMLFGRPLDLIGIIGIILLIGIVKKNGIMLVD
FT                   VAIDAERHGHASAEEAIYDACLLRFRPILMTTMCALLGGVPLMLGTGTGSEIRQPLGYA
FT                   IVGGLLVSQALTLFTTPVVYLSMDRLSGALASLWGRKQASGIEPA"
     atgaacctct cggccggctt catcacccgc ccgatcgcga ccgcgcttct gatggtcgcc        60
     atcgtggtgc tgggcgcgat tagctacacg ctgctccccg tcgcggcgct gccgaacatc       120
     gacacgccca ccatccaggt cacggcccag ctcccgggcg ccgatccgag cacggtcgcc       180
     tcctcggtcg cgactcagct cgaacggcag ttcggccaga tccccggtct cactcagatg       240
     acgtcgagca gcggcaccgg cttcacccag atcaccctgc agttcgaccg cagccgcacc       300
     gtcgactcgg cggctggcga cgtgcaggcc gcgatcaacg ccacgcaggg gcagctgccg       360
     gccgctcttc tcaacccgcc gacctaccac aagaccaatc cggccgacac gccgatcctg       420
     ctgatcgcgc tgacctcgga cgtgctgccg atcatgacgg tcagcgacta cgcgaactcg       480
     atcctcgccc agaagatctc gcagatcccg ggcgtcggct tcgtcggggt gggcggcctg       540
     cagagcccgg ccctccgcat ccaggtcaat cccgcgcagc tcgcggccga gaacctcgac       600
     ttcgagaccg tccgctctgc cctcgcgaac ctgaccgtcc tccagccgaa gggccagctc       660
     tacggccccc agcaggcggt cgccctgcag accaacgacc agcttatgac cgtgtccggc       720
     ttcgaggacg ccatcgttgc ctaccgcaac ggcgccccta tccgggtccg cgacatcggc       780
     cgtgtggtca aggccccgca ggacaccaca ctcgccgggt ggctgaacga gaagcccgcc       840
     gtgctcttgg ccgtccagcg ccaaccgggc gccaacgtca cctcgaccgt tgcggcgatc       900
     aaggccgccc tgccgcagct ccgcgcatcg ctcccacccg gaatccaagt cgagatggtc       960
     tccgaccgca ctcagaccat ccaggcgagc ctcgcggacg tccagttcac gctcctcctc      1020
     acgatcgcgc tggtggtcgg ggtgatcgcg ctgttcctgc gcaagctctg ggcgaccgtg      1080
     atcccggcga tcgccgtgcc gatctcgctg gtgggcacct tcgcggtcat ggatgcgctc      1140
     ggctactcgc tcgataacct gtccctgatg gcgctcacca tcgcgatcgg cttcgtggtc      1200
     gacgacgcga tcgtcatggt cgagaatatc gtacgccaca tcgaggaggg cgcggcgccg      1260
     ctgcaggccg cgctcaaggg ggcgggcgag atcggcttca ccatcctgtc gatctcgatc      1320
     tcgctgatcg cggtgttcat cccgttcttc ctgatgggcg gcgtcgtcgg cctgctgttt      1380
     cgcgagttcg ccgtcacggt ggcagtctcg atcctcgtct cggtggtggt atcgctgacg      1440
     ctgaccccga tgctctgcgc gcggctgctc ccggccggcg agggcagtcc cgggcggatg      1500
     tcgcgtctcc tggaggattt cttcacctgg ctgacccggg cgtacgggcg cgggctccgg      1560
     gttgctctgc gccaccgctt cctcacgctg atgagcttcc tcgccacggt cgcgctcacc      1620
     ggatacctct tcgtgatcat cccgaagggc ttcttcccgc agcaggatac gggcctgatc      1680
     atcggcatca gcgaggcggc ccaggacgtc tctccgcaag gcatgcgcca gcgccaggag      1740
     gcgatcctcg ccatcgccag ccgcgacccg gcagtggcct ctgcggtcgg ctacatcggg      1800
     ccgggcggcc cgaccgtcac ggagaacaac ggccgcgtct tcatcaccct gaagcccgag      1860
     ggcgagcggg acgtcaccgc ggatcaggtc atcgtccgcc tcggcaaggc actggagcag      1920
     gtccagggca tcacgctcta catgcaggcg gcgcaggaca tcaccattgg tagccgcctg      1980
     tcgaagacgc agtaccagta cacgctcacc gacgtgaatc tcgacgagct gaacctctac      2040
     gcgccgaagc tcctggaggc gctccggagg ctgcccgaac tcaccgcggt ggcgagcgac      2100
     cagcaatcga ccgcgcgcac gctcaccgtc gagatcgacc gcgccgccgc ctcccgcctc      2160
     gggatcgacc cgtcgctcgt ggacgcgacg ctctacgacg cgttcggaca gcgccacgtg      2220
     gcgcggatct acacggcgct caaccagtac tacgcgatcc tggaggtcgc cccgagctac      2280
     caactcggcc cggcggcgct caaccggatc tacgtccgct cgcagagcgg cacctcggtt      2340
     ccgatcagcc agatcgcccg tctcgtgccg ggtgtcgcgc cggcggctgt caaccaccag      2400
     ggccagtttc cgtccgtcac cctgagcttc aacctggcgc cgggcgcgac gatcggggcg      2460
     gcggtcgccg cggtgcagaa ggcgacggtg gatctccacc tgccgccctc gatcgcgacg      2520
     agcttccagg gcaacgcgca ggccttccag agttcgctcg gcagcacccc gccgctgatc      2580
     ctggcggccc tgttcgcggt ctacgtcatc ctgggcatgc tctacgagag cacgatccat      2640
     cccctgacca tcctgtcgac gctcccgtcc gcgggtttgg gggcgctcgc cacgttgatg      2700
     ctgttcggcc gccccctcga tctgatcggg atcatcggca tcatcctgct gatcggcatc      2760
     gtgaagaaga acggcatcat gctggtcgat gtcgcgatcg acgccgagcg gcacggccat      2820
     gcatcggcgg aggaagcgat ctacgacgcc tgcctgctgc gctttcggcc gatcctgatg      2880
     accacgatgt gcgcgctgct gggcggcgtg ccgttgatgc tcgggaccgg gacgggctcg      2940
     gagatccggc aacctctcgg ctacgccatc gtgggtggcc ttctcgtgtc gcaggctctc      3000
     acgctgttca cgacaccggt cgtctacctc tccatggatc ggcttagcgg cgcgctggca      3060
     tcgctgtggg gacggaagca agcgtcagga atcgagccag catga                      3105
//

If you have problems or comments...

PBIL Back to PBIL home page