(data stored in ACNUC7421 zone)

EMBL: CP001349.PE521

CP001349.PE521       Location/Qualifiers
FT   CDS_pept        complement(600864..602009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0533"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bja:blr0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55573"
FT                   /db_xref="GOA:B8ICI5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL55573.1"
FT                   /translation="MLVASLTLAAVGFAAELHLAGQQHQIQPAPPSPVPVVIATVQQHD
FT                   VPLVLSGVGTVQALNAATVRTQVTGILENVEFTEGQFVKRGDVLATIDPRIYQAQLDQA
FT                   RAQLARDQALLTNQETNLRRDEPLLQRGFATDQQVVTERAQIAQTQSTLRADQALIDNA
FT                   ATQFDFATLRAPFDGVTGVRLIDVGNVVHPTDPTGIVVLTQVQPISVIFTLPSADIPAV
FT                   QEALARGPVQTAIYDQSGTRQLDTGTLLLINNQADPNSGTVQLKATFPNAHRQLWPGTF
FT                   VNAQVITSVGRGALTIPTDAVQQNDRGQYVFVVGPDRTVSMRPVRVAQRVRGTALIASG
FT                   LTAGESVVVQGQYRLTPGTAVVSAPASEVPNTTTASAGMLP"
     gtgctcgtgg cgagcctgac gcttgctgct gtcggatttg ctgctgaact ccaccttgcg        60
     ggccagcagc accaaattca gcctgctccg ccatcacctg ttccggtcgt catcgccacc       120
     gtccagcagc acgacgtgcc gctggtcctg agcggggtcg gcacagttca ggcgctcaat       180
     gcggcaaccg tccggacaca ggtcacgggc atcctcgaga acgtggaatt caccgagggg       240
     cagttcgtca agcgcggcga cgtgctggcg acgatcgatc cacgcatcta ccaggcgcag       300
     ctcgatcagg cccgcgccca gctcgcccgc gatcaagccc tcctcaccaa ccaggagacg       360
     aacctcaggc gcgacgagcc gctcctccag cgcggcttcg ccacggacca gcaggtcgtc       420
     accgagcggg cccagatcgc gcagacgcag agcaccttga gggctgacca ggccctgatc       480
     gacaacgccg cgacgcagtt cgacttcgcg actctgcgcg cacctttcga cggcgtcacg       540
     ggcgtgcggc tcatcgacgt cggcaacgtg gttcatccca cggacccgac cggcatcgtg       600
     gtgctgaccc aggtgcaacc gatcagcgtg atcttcactc tcccgtccgc ggacatcccg       660
     gccgtgcaag aggcgctggc gcgcggaccc gtccagaccg ccatctacga ccagtcgggc       720
     acgcgccagc tcgacaccgg caccctgctc ctgatcaaca accaggcgga cccgaactcc       780
     ggcacggtcc agctcaaggc gaccttcccg aacgcgcacc ggcagctctg gccgggtact       840
     ttcgtgaacg cccaggtcat cacctcggtc ggccgcggcg ccctgaccat cccgaccgac       900
     gccgtgcagc agaacgaccg agggcagtac gtcttcgtcg tcggtccgga ccgcacggtc       960
     tcgatgcgcc cggtccgcgt cgcgcagcgc gtgcggggca cggccctgat cgcgtcgggc      1020
     ctcaccgccg gcgagagcgt ggtggtgcag ggccagtacc gcctcacgcc cgggacggcc      1080
     gtcgtgagcg caccggcctc cgaggtcccg aacaccacta cggcgagcgc ggggatgctg      1140
     ccatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page