(data stored in ACNUC7421 zone)

EMBL: CP001349.PE522

CP001349.PE522       Location/Qualifiers
FT   CDS_pept        602629..603297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55574"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55574.1"
FT                   /translation="MTRPSERPGDSQHDAAQPCVCGDIVEPAVPQHGRLQSRRYEWQLK
FT                   HLKWRHARKLTGRALSEHGEHVGLCQYGGGCKQWGSQRDVPLQAMAGQLDIDELSAFAR
FT                   RGHDQVGEGSECIEIESFVPLGRVPTPQENRESAVEEPTVCEPLARRSEATECEINLTA
FT                   VESLGKVDGTAWAQIETNTRSLCGDGGCKRRREDQRRAIVDRNRETTLGSIRVELRRTF
FT                   "
     gtgacgaggc cgtctgaacg cccgggcgac tcgcaacacg atgctgcgca accatgcgtg        60
     tgcggcgaca tcgtcgaacc ggcggtgcca cagcatggcc gtttgcaatc tcggcgatac       120
     gaatggcagc tgaagcacct caagtggcgc cacgcgcgca aactcacggg ccgcgcgctc       180
     tccgagcacg gcgagcatgt cggactgtgc cagtacggcg ggggttgcaa gcagtggggc       240
     tcgcagcgcg atgtgccgct gcaagccatg gcgggccagc tcgacatcga cgaactcagt       300
     gccttcgcgc gtagaggaca cgatcaggtg ggggaaggct ccgagtgcat cgagatcgag       360
     agtttcgttc cgctcggcag ggtgcccacg ccgcaggaga accgcgaatc cgccgtcgaa       420
     gagcctacgg tctgcgaacc gctcgcccgg cgcagcgagg ccaccgagtg cgagatcaat       480
     ctcaccgcgg tcgagtcgct cggcaaggtc gatggtaccg cttgggcgca gattgagacc       540
     aatacccgta gcctctgcgg cgatggcggc tgcaagcggc gccgcgagga tcagcgccgc       600
     gctattgtcg accgcaatcg tgaaacaacg ctcggcagta ttcgggtcga actccgccgc       660
     accttctaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page