(data stored in ACNUC7421 zone)

EMBL: CP001349.PE523

CP001349.PE523       Location/Qualifiers
FT   CDS_pept        604133..605008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0536"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mex:Mext_4689
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55575"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL55575.1"
FT                   /translation="MTELNPSGTFAIGGDLVVHRLGFGAMRITGPGIWGEPASREAAIA
FT                   TLRRVPELGVDLIDTADSYGPFVSEDLIREVLHPYTGLVIATKGGLTRHGPDIWRPVGN
FT                   PDYLRQCVLMSLRRLGLERIDLWQLHRIGPDCPREVQFEAIARMRDEGLIRHVGLSEVS
FT                   IDDIQAAQRFFPVAAVQNRYNLVDRTSEAVLDYCESAGIGFIPWAPLDRGALARYGSAI
FT                   AQAAARHSVGEGAIALAWLLKRSPVMLPIPGTGDPEHLAENMRGATVELTSEEFNALDQ
FT                   EGRAAWQAAR"
     atgaccgaac tcaatccgtc cggcaccttc gcaatcggcg gcgacttggt ggtgcaccgt        60
     ctcggcttcg gtgccatgcg catcaccggg ccaggcatat ggggcgagcc ggcctcccga       120
     gaggcagcga tcgcgaccct gagacgcgtg ccggagcttg gcgtcgacct gatcgacacc       180
     gctgacagct acggtccgtt cgtcagcgag gacctcatcc gcgaggtgct gcacccgtac       240
     acgggtcttg tgatcgcgac aaagggaggt ctgactcgcc atgggccgga tatctggcgt       300
     ccggtcggca accccgatta cctgcgccaa tgcgtgctga tgagccttcg tcggctcggc       360
     ctggagcgca ttgatctttg gcagctccac cgcatcggcc ctgactgtcc ccgcgaggtc       420
     cagttcgagg cgattgcgcg gatgcgcgac gagggcttga tccggcatgt cggcctaagc       480
     gaggtctcga tcgacgacat ccaggctgcg cagcgattct tccccgtcgc ggcagtgcag       540
     aaccggtaca atctggtcga ccgaaccagt gaggcggtgc tcgactactg cgaatcggcc       600
     ggcattgggt tcattccatg ggctcctctg gatcgtgggg cgctggcccg ctacggctca       660
     gccatcgctc aagctgcagc ccggcacagt gtgggagaag gagccatagc gctcgcttgg       720
     ctcctcaagc gctctcctgt catgctgcca atcccgggta cgggcgaccc tgaacatctt       780
     gccgagaaca tgcggggcgc caccgttgag ctgacttctg aagagtttaa cgctcttgat       840
     caggaggggc gggccgcttg gcaggcggca cggtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page