(data stored in ACNUC7421 zone)

EMBL: CP001349.PE524

CP001349.PE524       Location/Qualifiers
FT   CDS_pept        605472..605627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55576"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55576.1"
FT                   /translation="MPDNGKKADFQTPPATDPTAAGPPPPAAKISPDGKATSEVKGTGS
FT                   TDKAKS"
     atgcccgaca acggtaagaa ggccgatttc cagaccccgc ccgccacgga tccaactgcg        60
     gccggcccgc ccccgcctgc cgcgaagatc agcccggacg ggaaggccac ctcggaggtg       120
     aaaggcaccg gcagcacaga caaggcaaaa agctga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page