(data stored in ACNUC7421 zone)

EMBL: CP001349.PE525

CP001349.PE525       Location/Qualifiers
FT   CDS_pept        complement(605633..606073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55577"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55577.1"
FT                   /translation="MTGMTDRPTIGDLLRLKIVSRDELQAAVDGYIADPKPGWREIAGG
FT                   VGIDIAAAVNADAHTKQLMRWSDVPLATREMALRTAILMAKPEGMWRTRLPRPRGIARV
FT                   VSAMPQMQEDLWPSRAERRLSMQSGAQQDRNPPPGVLLPDHR"
     atgaccggca tgacggaccg gcccaccatt ggcgacttgc tcagactcaa gatcgtgagc        60
     cgcgacgagc tgcaggcggc cgtggacggc tacattgctg acccgaagcc gggctggcgt       120
     gaaatcgcag gcggggtcgg catcgacatc gcggcggctg tcaacgctga cgcccataca       180
     aagcagctga tgaggtggtc ggatgtgccg ttggcgacgc gtgagatggc gctaaggaca       240
     gcgatcctaa tggccaagcc ggagggcatg tggcggacca ggttgccacg cccaagaggg       300
     attgctcggg tggtcagcgc aatgccacaa atgcaggaag acctctggcc ctcgcgagct       360
     gagaggcgcc tttccatgca gtcaggcgcc cagcaggatc ggaaccctcc gccgggcgtt       420
     ttgctgccag accatcgttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page