(data stored in ACNUC7421 zone)

EMBL: CP001349.PE526

CP001349.PE526       Location/Qualifiers
FT   CDS_pept        complement(606241..606471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55578"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55578.1"
FT                   /translation="MPLKRELVAMSFKDRVAALMQCADHHLEEMDRLEDRGQTGRLSEW
FT                   DRRQLSSHRASLKRVLDRALEFGIKLSVVEE"
     atgcctctta aaagagaact ggtggccatg tcgttcaagg accgcgtggc cgcactgatg        60
     cagtgtgcag accaccattt agaagagatg gaccgccttg aggatcgggg gcaaacgggc       120
     cgcttgagtg agtgggatcg gcggcagctt tctagccacc gcgctagtct gaagcgagta       180
     cttgaccgcg cgcttgagtt cggaatcaag ctgtctgtcg tggaggagta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page