(data stored in ACNUC7421 zone)

EMBL: CP001349.PE528

CP001349.PE528       Location/Qualifiers
FT   CDS_pept        complement(609625..611337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0542"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rpt:Rpal_3326 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55580"
FT                   /db_xref="GOA:B8IDK8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK8"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL55580.1"
FT                   /translation="MAASMALGVAPWGLSAGRIADPLTVTVLPNCKRLVKSMVATVPEI
FT                   KFPEIIIGIVAPIGAEVNACVREFVKYFKKAEYEVVEIKVTDVFRKLKNYIEPTTNLEE
FT                   APLFVRYDIYTSYGNQLRSEFSDDILAATSLGRIVKSRPNLPRQHGQRAFERVVYIVHQ
FT                   FKRKEEIDLFRAVYGRLFFQVSVYSRRGARVDYLAQRFANSDNSANPNMYRYHAENLVQ
FT                   RDENEKDEHGQKVSKVFHDADFIINSDIRSPSIENQIIRFCDLLFGSNSISPTKVEYGM
FT                   FIAKAAALRTLDLSRQVGAAIFTNNGEIVSMGSNEVPKGQGGTYWGDDGLDDREYVREH
FT                   DSNDRRKLEILSEITGILNLKIEDVMKIKGIRDSQFMDALEYGRIVHAEILAISDAARL
FT                   GRSTHDTVLYCTTFPCHMCAKHIVASGVKKVVFLEPYPKSLVADLHSDSISIENSDRGR
FT                   YEDFQAVDFEHFHGITPRRYRELFERGKRKDDNGKFRQWNKGNLPSPQPNLGVNVPFYQ
FT                   QIEKLIFEDYLGGQLKNKGIDPSVLDPETSGGESASTSSTDAPQDVSGKFLQL"
     atggccgctt caatggcgct aggtgtggca ccctggggct tgtcggcagg tcgcatcgct        60
     gatcctctta ccgtcacggt gctaccaaac tgtaaacggt tggtgaagag catggttgct       120
     acagtccccg agataaaatt cccggaaatc attatcggta ttgtggcgcc aataggcgct       180
     gaagtgaatg cctgtgttcg cgagttcgtt aaatatttca agaaagcaga gtatgaggtt       240
     gtagaaatca aggttactga tgtttttaga aagctaaaaa attacattga gccgaccaca       300
     aatttagaag aggccccgtt atttgtgagg tatgacatat atacttcgta cggaaatcag       360
     cttcgttctg aattttctga tgatattcta gctgctacct cgcttggtag aattgtcaaa       420
     tcgcgcccta atcttccgcg tcaacatggg cagcgtgcgt ttgagcgcgt cgtttacatt       480
     gttcatcagt tcaagaggaa ggaggaaatt gaccttttcc gtgcagttta cggcaggttg       540
     ttctttcaag tttcagttta ttcgcgtcgc ggggctagag tcgactatct ggcgcagagg       600
     tttgcaaata gcgataattc tgcaaatcca aatatgtacc gctatcatgc tgaaaactta       660
     gttcagcgcg atgaaaacga aaaagatgaa catggtcaga aggtctctaa ggtgtttcat       720
     gatgcagatt tcataatcaa cagcgatatt cgtagcccct cgattgaaaa tcaaataata       780
     agattttgtg atcttctttt tggatcgaat agcatatcgc caacaaaagt agaatatgga       840
     atgttcatag cgaaggcggc cgcattgcgg accttggatc tctcaagaca agtgggtgcg       900
     gcgattttta ccaataacgg cgagatagtt tcgatgggct ctaacgaggt ccccaaagga       960
     caaggaggga cttattgggg cgatgatggt cttgacgatc gtgagtatgt tcgcgaacac      1020
     gactcgaacg atagaagaaa gttagaaata ctttcggaaa taacaggaat attgaactta      1080
     aaaattgaag atgttatgaa gataaaggga attagagact ctcaatttat ggatgctttg      1140
     gagtatggca gaattgttca tgcggaaata cttgcaatct cagatgccgc tagacttggg      1200
     agatctactc acgacacggt actttactgt actacgtttc cttgccatat gtgcgcaaaa      1260
     cacattgtgg catcaggggt caaaaaagta gtctttctag agccttatcc taaaagcttg      1320
     gtggccgatc ttcatagcga ctcaatttcc atcgaaaata gcgatcgcgg ccggtatgaa      1380
     gattttcagg cagttgattt cgagcacttc catggaatta cgccgcgcag gtatcgtgag      1440
     ctttttgagc gtggcaagag aaaggatgat aatggcaaat tcagacagtg gaacaaggga      1500
     aatctaccat cacctcaacc aaatttgggc gtgaacgtac ccttctatca gcagattgaa      1560
     aagctaattt ttgaagatta tcttggaggg caactcaaga acaagggtat agatccttct      1620
     gttctggatc ctgagacatc gggaggggaa tctgctagca cttcttctac ggatgcgcca      1680
     caggatgtct ctggtaagtt tttgcagctt tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page