(data stored in ACNUC7421 zone)

EMBL: CP001349.PE53

CP001349.PE53        Location/Qualifiers
FT   CDS_pept        complement(60575..61591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0054"
FT                   /product="putative periplasmic substrate-binding
FT                   transmembrane protein"
FT                   /note="KEGG: met:M446_0054 putative periplasmic
FT                   substrate-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55105"
FT                   /db_xref="GOA:B8IU60"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU60"
FT                   /inference="similar to AA sequence:KEGG:M446_0054"
FT                   /protein_id="ACL55105.1"
FT                   /translation="MLGQKWLRLAAGAAIALGLATMPLRAEVSEVRISKGYGILYLPLF
FT                   VMQEKKFLEAQAAKAGLGDVKVTWLTLDGGNVINDAMIAGSLDIAGTGAPGFLALWSKG
FT                   RGSPKTEVIGVSGMSTTALDLNVNKAEIKSLADFTPKDKIAIPGIKTSLAAVVLQMAVA
FT                   KQFGPENYGKLDASTVGLPHPEAVAALLSGKTEIVAHFASPPFTQVERADPKIRTILKA
FT                   SEVFGPITLDVVFALKRFTEANPKLTQAFLDALDQANAFIQENKAETAEIFARASKVKV
FT                   TPEEVRPMLDDPDSRFSSTPTGIMEFATFMHRVGIIKTKPAAWTDLFIPALRERAGS"
     atgttgggac agaaatggct gaggctcgcc gctggcgccg cgatcgcgct cggcctcgcg        60
     acgatgccgc tgcgggccga ggtctcggag gtgcgcatct cgaagggcta cggcatcctc       120
     tacctgccgc tcttcgtcat gcaggagaag aagttcctgg aggcccaggc ggccaaagcc       180
     ggcctcgggg acgtgaaggt gacctggctc accctcgacg gcggcaacgt catcaacgac       240
     gccatgatcg cgggctccct cgacatcgcc gggaccggcg cgccgggctt cctcgccctc       300
     tggtccaagg ggcgcggcag cccgaagacc gaggtgatcg gcgtctcggg catgtccacc       360
     acggcgctcg acctcaacgt caacaaggcc gagatcaagt cgctcgccga cttcacgccc       420
     aaggacaaga tcgcgatccc gggaatcaag acctcgctcg ccgcggtcgt cctgcagatg       480
     gcggtcgcca agcagttcgg gccggagaac tacggcaagc tcgatgcgag cacggtcggg       540
     ctgccgcatc cggaggcggt tgcggcgctc ctgtcgggca agaccgagat cgtggcccat       600
     ttcgcctcgc cgcccttcac ccaggtcgag cgcgcggacc cgaagatccg caccatcctc       660
     aaggcgtccg aggtcttcgg cccgatcacc ctcgacgtgg tcttcgccct caagcgcttc       720
     accgaggcca acccgaagct cacccaggcc ttcctggacg ccctcgatca ggccaacgcc       780
     ttcatccagg agaacaaggc cgagacggcc gagatcttcg cccgcgcctc gaaggtgaag       840
     gtgacgcccg aggaggtccg gccgatgctg gacgaccccg acagccggtt ctcgtcgacc       900
     ccgaccggca tcatggaatt cgcgaccttc atgcaccgcg tcggcatcat caagacgaag       960
     ccggccgcct ggacggacct gttcattccc gcccttcgcg agcgggcggg gagctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page