(data stored in ACNUC7421 zone)

EMBL: CP001349.PE530

CP001349.PE530       Location/Qualifiers
FT   CDS_pept        611993..612391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55582"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL0"
FT                   /inference="similar to AA sequence:KEGG:mlr0242"
FT                   /protein_id="ACL55582.1"
FT                   /translation="MRVLLIGYDPDTVDFSDPALPPGLDAEKIHTGIALALKQMRERGW
FT                   KVDHCFIHPDATAAAAVKQQVMSETYDCIVIGAGVRLWSRHIAVFEAVINAVHKAAPQA
FT                   MIAFNTRPEDSADAAERWLPFSQDRPSS"
     atgagagttc tgctgattgg gtacgatccg gacacggtcg acttttctga cccggctttg        60
     ccgcctgggc ttgacgctga gaagatccac acgggcattg cgctcgcgct aaaacagatg       120
     cgagagcgcg gatggaaggt cgatcattgc ttcatccacc ctgatgcgac ggctgccgct       180
     gcggtcaaac aacaggtgat gtcggaaacc tacgactgca tcgtcattgg agccggtgtt       240
     cgtctctggt cccgccacat cgcagtgttt gaggcagtca tcaacgcggt gcacaaggct       300
     gccccacagg caatgatcgc cttcaacacg cgccctgagg acagtgctga tgccgcggag       360
     cgctggttgc cattttctca ggaccgtcca agctcgtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page