(data stored in ACNUC7421 zone)

EMBL: CP001349.PE531

CP001349.PE531       Location/Qualifiers
FT   CDS_pept        complement(613011..613421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: met:M446_6972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55583"
FT                   /db_xref="GOA:B8IDL1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL1"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL55583.1"
FT                   /translation="MAKCFHLALIQQLETAIPADVTDELRRRLRATVAEKPLGKQHVAQ
FT                   LMGIHRRTLARLLKSEGTSFKLVADETRLSIAKQLLADTNLSLAQISATLEFSEPAAFT
FT                   RAFRRRTGTTPSAGRKEHRRRHVARNVQTALG"
     atggccaaat gcttccatct agcactaatc cagcagcttg agacggccat tcccgctgac        60
     gtgacagacg agcttcgccg gcgcttgcgc gccacggtgg ctgagaagcc cctcggcaag       120
     cagcacgtcg cgcagctgat ggggatccat cggcgcacgc tggcccgcct gctgaagtcc       180
     gaaggcacga gcttcaaact ggtcgctgat gaaacgcggc ttagcatcgc gaagcaactg       240
     ttggccgaca ccaacctgag cttggcgcag atctcggcca cgctggagtt ctcggagccg       300
     gccgccttca cgcgcgcctt ccggcgcagg accggcacga caccgagcgc ggggcggaag       360
     gaacaccggc gtcgccatgt ggcgcggaac gtccagacgg cgctcggcta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page