(data stored in ACNUC7421 zone)

EMBL: CP001349.PE532

CP001349.PE532       Location/Qualifiers
FT   CDS_pept        613427..613627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55584"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55584.1"
FT                   /translation="MRRLAPAICSGNCICKTQQCSLKLASSYANIVSSICKDRKFDEKL
FT                   PNEINNFSVKFTRHRRLIALQ"
     atgcgtcgct tggcccccgc catctgtagc ggcaattgca tttgtaaaac gcaacaatgc        60
     tctctcaagc tcgcgagcag ctatgccaac atcgtcagct cgatctgcaa ggatcggaag       120
     ttcgatgaga agcttcctaa tgagatcaac aacttcagcg tcaagttcac gaggcacagg       180
     cgtctcattg cgctccaata a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page