(data stored in ACNUC7421 zone)

EMBL: CP001349.PE533

CP001349.PE533       Location/Qualifiers
FT   CDS_pept        613566..614345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55585"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55585.1"
FT                   /translation="MRSTTSASSSRGTGVSLRSNNVPLHKLFPSIYAIHIAHTHLVNAV
FT                   EVTPIVHRLSPPTSRLYRPSLAWRFREARKPMYGTRRARHGRTGRARHRGKARTSRVRL
FT                   PHEECDTQHLEAAMYSKRPSKLIFGTLLATPFISLVAVAEQCPQSGEESGPARPASPSV
FT                   LVRFSQWFIRHGITQERYTFHASGAYEYVRAAGETVRAWEDGSYTVKSDHLILSPEGGR
FT                   PRTICWRIGTYTGEGYRPILWLSTPDGREEHFSPTMP"
     atgagatcaa caacttcagc gtcaagttca cgaggcacag gcgtctcatt gcgctccaat        60
     aatgtgcctc tacataagct ttttccatca atttatgcaa tccatattgc gcatactcac       120
     ctcgtgaacg ctgtcgaggt tactcctatc gtccacaggt tgtctccgcc aacttcaagg       180
     ctgtatcgcc cctcactcgc gtggaggttt cgcgaggccc gtaagccgat gtatggaacg       240
     agaagagccc gccacggcag gaccgggcgg gctaggcatc gaggcaaagc aagaacgagt       300
     cgtgttcggc tgcctcacga agaatgcgac acacagcatc tggaggccgc gatgtatagc       360
     aagcgaccat caaagctgat cttcggaacc ttgctggcca ccccctttat ctcgttggtt       420
     gctgttgcag aacaatgccc gcaaagtggt gaggagagcg ggcccgctcg tccagcatca       480
     ccttcggtac ttgtgagatt cagtcaatgg tttatccgac atgggatcac acaagaaaga       540
     tacactttcc acgcgagcgg agcatatgaa tacgtgagag ctgcggggga aacggtccga       600
     gcgtgggaag atggttccta tactgtgaag agtgaccacc tcatcctcag cccagaaggg       660
     gggcgaccgc ggactatttg ctggaggatc ggaacttata caggtgaggg ctatcgacct       720
     attctatggt tgagtactcc agacggaaga gaggagcatt tttcccccac tatgccgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page