(data stored in ACNUC7421 zone)

EMBL: CP001349.PE534

CP001349.PE534       Location/Qualifiers
FT   CDS_pept        complement(614934..615140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55586"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL4"
FT                   /inference="similar to AA sequence:KEGG:M446_6420"
FT                   /protein_id="ACL55586.1"
FT                   /translation="MADTESFDLVAEFNALLFEAGSIWDVIDRRQGHEVTLTLPTEHEA
FT                   RVICEEWNRQEGRERFKVVKRAA"
     atggctgaca ccgagagctt cgacctcgtg gccgagttca acgccctcct cttcgaggcc        60
     ggcagcatct gggacgtgat cgacaggcgc cagggccacg aagtgaccct gaccctcccg       120
     actgagcatg aggcccgcgt catctgcgag gagtggaacc ggcaggaagg ccgggagcgg       180
     ttcaaggtcg tgaagcgggc ggcctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page