(data stored in ACNUC7421 zone)

EMBL: CP001349.PE535

CP001349.PE535       Location/Qualifiers
FT   CDS_pept        615499..615942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0549"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6603 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55587"
FT                   /db_xref="GOA:B8IDL5"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL5"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55587.1"
FT                   /translation="MPNDISITTANDASSLSTIAITADIVSAFLAHNQIPAASLPPLLT
FT                   SVHASLARLTKPAEPAPEPLVPPVPIKKTVTPDAIISLEDGKPYKTLARHLAGRGLTPE
FT                   QYRQKWGLPANYPMTAANYSSQRSELAKKSGLGQKAPSRKTGT"
     atgcccaatg acatcagcat caccaccgcg aatgacgcca gctcactcag cacgatcgcg        60
     atcacggctg acatcgtctc ggctttcctg gcgcataacc agatcccggc agctagcctg       120
     ccgcccctcc tcactagcgt acacgcctcg ctggcgcgcc tgaccaagcc ggccgagccc       180
     gcgcccgagc cgctcgtccc gcccgtgccg atcaagaaga cggtgacgcc ggacgccatc       240
     atcagcttgg aggacggcaa gccctacaag acgctggccc ggcaccttgc cgggcgcggg       300
     ctgaccccgg agcagtaccg ccagaagtgg ggcctgccgg cgaactaccc gatgacggcc       360
     gcgaactact cctcgcaacg ctccgagctg gcgaagaaga gcggccttgg ccagaaggct       420
     ccaagccgga agaccggcac ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page