(data stored in ACNUC7421 zone)

EMBL: CP001349.PE536

CP001349.PE536       Location/Qualifiers
FT   CDS_pept        616089..616337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55588"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL6"
FT                   /inference="similar to AA sequence:KEGG:M446_1863"
FT                   /protein_id="ACL55588.1"
FT                   /translation="MPIYLDDEWHAFLSDETRVKRVYRDEVLIGRVRRWQVSEPGELTR
FT                   EWYTAERCEGSLFVQIEGKQPDFEEALQRVVFYGVAH"
     atgccgatct acctcgacga cgaatggcac gcctttctga gcgacgaaac tcgtgtgaag        60
     cgcgtctatc gggacgaagt cctaatcggc cgggtgcggc ggtggcaggt gagtgagccg       120
     ggcgaactga cccgagagtg gtacacggcc gaacgatgtg aaggcagcct gttcgtgcag       180
     atcgagggca agcagcccga cttcgaggag gccttgcagc gggtcgtttt ctacggcgtc       240
     gctcattga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page