(data stored in ACNUC7421 zone)

EMBL: CP001349.PE537

CP001349.PE537       Location/Qualifiers
FT   CDS_pept        616337..616603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55589"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55589.1"
FT                   /translation="MSCRSPRRAYDENGREILPPTIDMLRAEANRTAAVNLLLPARDKE
FT                   IGLARLVLRASSAPAARSRMPGLYSARSNQQFHVSAEASSPAG"
     atgagctgcc gcagcccccg ccgcgcctac gacgagaacg gccgggagat cctgccaccg        60
     acgatcgaca tgctccgggc agaggccaac cgaaccgcgg cggtcaacct tctgcttcca       120
     gcgcgtgaca aggagatagg gctcgcccgg ctcgtgctca gggcttcgag cgccccggcg       180
     gcccgctcca ggatgccagg gttgtactcg gcccgctcga accaacaatt tcacgtcagc       240
     gccgaagcca gctcgcccgc gggttaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page