(data stored in ACNUC7421 zone)

EMBL: CP001349.PE538

CP001349.PE538       Location/Qualifiers
FT   CDS_pept        complement(616600..616833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_3603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55590"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL8"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3603"
FT                   /protein_id="ACL55590.1"
FT                   /translation="MKTFLVTAVCAVGIFSISPASAQNIEIGPGGPSVDFRSRGERERD
FT                   IERQEMRRDRAIERRREYRREQELRRDEDDED"
     atgaaaacat tccttgtgac cgccgtttgc gcggtgggga ttttttcgat ctcaccagcc        60
     tcagcccaga acatcgaaat cggccctggc gggccgagcg tcgacttccg ctcacgaggg       120
     gaacgcgagc gcgacatcga acgccaagag atgagacgag accgtgcgat cgagcgccgc       180
     cgcgagtacc ggcgagagca ggagctgcgc cgcgatgagg acgatgagga ttaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page