(data stored in ACNUC7421 zone)

EMBL: CP001349.PE54

CP001349.PE54        Location/Qualifiers
FT   CDS_pept        complement(61654..62532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0055"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0055
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55106"
FT                   /db_xref="GOA:B8IU61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU61"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55106.1"
FT                   /translation="MTTASTLGLDRRPEILRETSAAGAITVEQRLSLPELLYRQGWLRK
FT                   CAVLATLAVLWEVYGRWLDNPLLFPTFSATVEAFGTAILSGEIPAKALISLQTLAIGYG
FT                   IGIALAAILTTIAIGSRIGTDLLETLTAMFNPLPAIALLPLALIWFGLGQGSVVFVLVH
FT                   SVLWAIALNTHAGFRSVSNTLRMVGLNYGLRNLRLVRAILIPAAFPSILTGLKVGWAFA
FT                   WRTLIAAELVFGVSSGSGGLGWYIFENRNALETTNVFAGLFTVILIGLFVENVVFANIE
FT                   KRTIRRWGMQH"
     atgaccaccg cttccaccct cggtctcgac cgccggcccg agatcctgcg cgagacctcc        60
     gcggccggcg cgatcaccgt cgagcagcgc ctgtcgctgc cggaactcct ctaccggcag       120
     ggctggctgc gcaaatgcgc ggtgctcgcc accctcgccg tgctctggga ggtgtacggc       180
     cgctggctcg acaacccgct cctgttcccg accttctcgg ccaccgtcga ggcgttcggg       240
     accgcgatcc tgagcggcga gatccccgcc aaggcgctga tctcgctgca gaccctcgcc       300
     atcggctacg gcatcggcat cgcgctcgcc gcaatcctca ccacgatcgc catcggctcg       360
     cgcatcggca ccgacctgct cgagaccctg acggcgatgt tcaacccgct tccggcgatc       420
     gcgctcctgc cgctcgccct gatctggttc ggtctcggcc agggcagcgt ggtcttcgtc       480
     ctcgtgcatt cggtgctgtg ggcgatcgcc ctcaacaccc atgcgggctt ccgctcggtc       540
     tccaacaccc tgcggatggt cgggctgaac tacggcctgc gcaacctgcg gctggtgcgc       600
     gcgatcctga tcccggcggc cttcccgtcg atcctcaccg gcctcaaggt cggctgggcc       660
     ttcgcgtggc gcacgctgat cgcggcagaa ctcgtcttcg gcgtctcctc gggctcgggc       720
     ggcctcggct ggtacatttt cgagaaccgc aacgcgctcg agaccaccaa cgtctttgcg       780
     ggcctgttca ccgtgatcct gatcggcctc ttcgtcgaga acgtggtctt cgccaatatc       840
     gagaagcgga cgatccggcg ctggggcatg cagcattga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page