(data stored in ACNUC7421 zone)

EMBL: CP001349.PE541

CP001349.PE541       Location/Qualifiers
FT   CDS_pept        complement(617963..618247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0555"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: mrd:Mrad2831_6255 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55593"
FT                   /db_xref="GOA:B8IDM1"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM1"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6255"
FT                   /protein_id="ACL55593.1"
FT                   /translation="MPLYSKAGVITTDILPPAESPRALFGALDRERGGPLMAAMDACNR
FT                   RFGRGTVVPARAGLERKRTWATKFEMRSPRYTTKLAELPVATAHLWEPL"
     gtgccgctct acagcaaggc cggcgtgatc acgaccgaca tcttgccgcc ggcggagagc        60
     ccgcgggccc tcttcggcgc gctcgaccgg gagcgcggcg gcccgctgat ggcggcgatg       120
     gatgcgtgca accggcgctt cgggcgcggc accgtggtac cggcgcgggc gggactggag       180
     aggaaacgga cgtgggcgac caagttcgag atgcgctcgc cgcgctacac aacgaagttg       240
     gccgagctgc cggtcgcgac agcgcacctg tgggagccgc tttag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page