(data stored in ACNUC7421 zone)

EMBL: CP001349.PE542

CP001349.PE542       Location/Qualifiers
FT   CDS_pept        complement(618410..620704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0556"
FT                   /product="proprotein convertase P"
FT                   /note="KEGG: bid:Bind_3695 proprotein convertase P"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55594"
FT                   /db_xref="GOA:B8IDM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM2"
FT                   /inference="similar to AA sequence:KEGG:Bind_3695"
FT                   /protein_id="ACL55594.1"
FT                   /translation="MPSGGQNDDVFDGNPGVSDNFDGSGGSDTISYITSPRGVSINLAA
FT                   GATFDGVTFDFLSSIENAVGSDFNDTLQGDAGSNRLDGSGGNDTVSYASSTRGVSINLA
FT                   AGATFDGVTFDFLSSIENAAGSDFNDTLQGDAGSNRLDGGAGDDTVSYAASNRAVTIDL
FT                   AAQATYDGVVGDVLASIENAIGSQFDDSIQGGYGSNRLDGGAGNDTVFYAASTRAMTIN
FT                   LATQIADDGMFVDTLVSIENVQGTNFNDVIVGDAGNNTIDGGAGGSDTLQGGGGSDTVS
FT                   YGHASQGVSINLAAGATFDGVTFDLLSSIENAVGSDFNDTLQGDAGSNRLDGSGGNDTV
FT                   SYASSTRGVSINLAAGAAFDGVTFDFLSSIENAVGSDFNDTLQGGVGSNRLDGGAGDDT
FT                   VNYAASNHAITLDLASEYAYDGNSYDTLISVENVEGTGFNDLIYGDFKNNVIDGGAGGS
FT                   DTIYGGDGTDTISYSSASQGVSVNLAAGATYDGVTFDFLNSIENVVGSKFNDSLQGNSG
FT                   SNLFDGGAGTDTLSYTSSARELNVYLGSNSISDGNATDYYSNIESIVGSGLYDRFVVSG
FT                   SDFGSVKNIDGSGGLDTLDLAGSNITTILYNGINVNLASHYVYADVSQPRVPQLGFSIY
FT                   NVENVNGSNLYDYIVGDDADNIINGGGGTPIFSRPIGRSGDILTGNGGNDTFVFVMGQA
FT                   NGDTITDFQGNGPSAGDRLEFRGFGTAEQGATLTQINATQYSINSADGKVHEVINLTNS
FT                   AVINSSDYTFV"
     atgccgtctg gcggacaaaa cgatgatgtt tttgatggca atccaggagt atccgataat        60
     ttcgatggaa gcgggggaag tgacactatt agttacataa cctcgcctcg cggcgtctcg       120
     atcaacctgg cggctggggc aaccttcgac ggggtcacat tcgactttct gagcagcatc       180
     gagaacgctg tcggctctga cttcaatgac acgcttcagg gcgacgccgg ctccaaccgc       240
     ttggacggga gcgggggtaa cgacaccgtc agctatgcga gttcgacccg gggcgtctcg       300
     atcaacctgg cggctggggc aaccttcgac ggggtcacgt tcgacttcct gagcagcatc       360
     gagaacgctg ccggctctga cttcaatgac acgcttcagg gcgacgccgg ctcgaaccgc       420
     ctggacggcg gcgcaggcga cgacaccgtc agctatgccg catcaaatcg cgcagtcacg       480
     atcgacctcg ccgctcaagc cacttacgac ggcgtggttg gcgatgttct ggcgagcatc       540
     gaaaatgcca ttggctcaca gttcgatgat agcatccaag gtggatacgg gtcgaaccgg       600
     ctagatggtg gtgcaggtaa tgacactgta ttctacgccg cttcaactcg tgcgatgacg       660
     atcaatctcg caacacagat agcggatgac ggcatgttcg ttgatacgct tgtgtcaatt       720
     gagaacgtgc agggcacaaa tttcaatgac gtcatagtcg gggacgcagg aaacaatacg       780
     atcgacgggg gtgcgggcgg atctgacacg cttcagggag gaggcggcag cgatacagtt       840
     agctatggtc atgcgtctca gggcgtctcg atcaacctgg cggctggggc aaccttcgac       900
     ggggtcacat tcgacctcct gagcagcatc gagaacgctg tcggctctga cttcaatgac       960
     acgcttcagg gcgacgccgg ctccaaccgc ttggacggga gcgggggtaa cgacaccgtc      1020
     agctatgcga gttcgacccg gggcgtctcg atcaacctgg cggctggggc agccttcgac      1080
     ggggtcacgt tcgacttcct gagcagcatc gagaacgctg tcggctctga cttcaatgac      1140
     acgcttcagg gcggcgtcgg ctccaaccgc ttggatggcg gcgcaggcga cgacaccgtc      1200
     aactatgccg catcaaatca cgcaatcaca ctcgatctcg caagtgagta tgcgtacgac      1260
     ggcaattcat atgatacgct tatatccgta gagaacgttg aaggtacagg cttcaatgat      1320
     ttgatctacg gagatttcaa aaataatgtc attgatggtg gtgcaggtgg atccgacact      1380
     atttatgggg gtgatggtac tgatacaatc agctacagtt ccgcctctca aggagtttca      1440
     gtcaacttgg cagctggcgc aacgtatgat ggtgtgacgt ttgacttcct caatagtatc      1500
     gaaaatgtgg tgggctccaa gtttaacgat tcgctccagg gtaattccgg gtcaaattta      1560
     ttcgacgggg gtgccggtac tgacacttta agctatacct cttcagctcg ggagctgaat      1620
     gtatacctgg gcagcaattc gataagcgac ggaaatgcta ctgattatta cagtaatatc      1680
     gagagtatag tggggtcagg tttatatgat cggttcgtgg tctctggcag tgattttgga      1740
     tctgttaaaa atatcgacgg ttcgggcggc ctagatacgc tcgatctcgc aggttctaac      1800
     atcacaacga ttttgtataa cggaattaat gtcaatcttg catcgcatta cgtttacgca      1860
     gatgtctccc aaccgagagt cccgcagcta ggtttctcta tctacaatgt cgaaaacgta      1920
     aatggcagca acctctatga ttatatcgtt ggagatgatg cggataatat aatcaacggt      1980
     ggaggaggaa ccccaatttt cagtagacca attggaagga gcggagacat tcttaccgga      2040
     aacggtggaa atgacacatt cgtatttgtg atgggccagg caaatggtga tacaataaca      2100
     gacttccaag gaaacggacc atccgccgga gatcggcttg aattccgagg ctttggaaca      2160
     gcggaacagg gcgctaccct aacgcaaata aatgcaactc agtatagcat aaactctgca      2220
     gatggaaaag ttcatgaagt gataaactta actaattcag cagtgataaa ctcatcagac      2280
     tacaccttcg tatga                                                       2295
//

If you have problems or comments...

PBIL Back to PBIL home page