(data stored in ACNUC7421 zone)

EMBL: CP001349.PE543

CP001349.PE543       Location/Qualifiers
FT   CDS_pept        complement(620838..622118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0557"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: met:M446_5531
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55595"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM3"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACL55595.1"
FT                   /translation="MSRRELERLSKEELIELVLRLQRPEKTSRTSSKPPSTDRKERREQ
FT                   ARPGGAKPGHEGHSRVISGDPDAVVEHRPDRCSCCGGALHGDLPAEVVSVAEQVELPEV
FT                   TPIVTQHQRLAVLCPSCGAHVVAPVPSAARGTPFGPRLHAVATYLKTFQALSYERLQAA
FT                   LSDLFGLTLSQGGLMNMLRRAQGYFRPGREAAVSALRRAAVVASDETGVRIEGCTAYHW
FT                   VFRSAEAVVHHASPTRGAVVVHEMMDGHRPVVWISDRYTAQQGHAAKHQTCLAHLARDV
FT                   AYAVEVSDDPGPLRLQLWLQAVFALAERVTDLAASTLSAKRRALERRLSEILSAPSRCD
FT                   LTRDLQAKIGRARDQLLVFLDHPGTVEITNNGCERLLRPAVVQRKVTNGYRARWAANGE
FT                   ADLRTVVDTARLTGARPFATILQTIGA"
     atgagccgcc gcgagcttga gcgcctgagc aaggaggagc tgatcgagct ggtgctgcgg        60
     ctgcagcgcc cagagaagac ctcgcgcacc tcctccaagc cgccctccac cgatcgcaag       120
     gagcggcgcg agcaggccag acccggcggc gccaagcccg gccacgaagg ccacagccgg       180
     gtgatcagcg gggatcccga tgcggtcgtc gagcatcgtc cggatcgctg ctcgtgctgt       240
     ggcggcgctc tgcacggtga tcttcccgcc gaggtcgtca gcgtcgccga gcaggtcgag       300
     ttgcccgagg tgacgccgat cgtcacccag catcagcggc tcgcggttct ctgcccgtcg       360
     tgcggggctc acgtcgtcgc tccggtgcct tcggccgcgc gcggcactcc gttcggcccg       420
     cggctgcacg cggtggcgac ctacctcaag accttccagg cgctctcgta tgagcggctg       480
     caggcggcgc tgtcggattt gttcgggctc acgctcagcc agggcgggct gatgaacatg       540
     ctccgccgcg cacagggcta cttccgtcct ggccgcgagg cggccgtgtc ggcgctgcgc       600
     cgggccgcgg tcgtcgcctc cgacgagacg ggcgtccgga tcgagggctg caccgcctac       660
     cattgggtgt tccgctcagc cgaggcggtg gtccatcacg cctccccgac gcgcggcgcc       720
     gtcgtggtgc acgagatgat ggacggccat cggcccgtgg tgtggatctc tgatcgctac       780
     accgcccaac aaggccacgc ggccaaacat cagacctgcc tggcgcatct ggcccgtgac       840
     gtcgcctatg cggtcgaggt cagcgacgac ccggggccac ttcgcctgca gctctggctg       900
     caggcggtgt tcgcgctggc cgagcgcgtc accgacttgg cggcctcgac gctctcggcc       960
     aagcgccggg cgctggagcg gcggctgtcg gagatcctgt ccgccccgag ccgctgcgat      1020
     ctgacccgcg atctgcaggc caagatcggc cgcgcccgcg atcagctcct ggtcttcctc      1080
     gatcatcccg gcacagtcga gattaccaac aacggctgcg agcgcctgct gcgcccggct      1140
     gtcgtgcagc gcaaggtcac caacggctac cgtgcgaggt gggcggccaa cggagaggcc      1200
     gatctccgca ccgtcgtcga cacagcccgc ctcaccggcg ccaggccgtt cgccaccatc      1260
     ctccagacca tcggcgcctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page